GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aguA in Pseudomonas fluorescens FW300-N1B4

Align Agmatine deiminase (EC 3.5.3.12) (characterized)
to candidate Pf1N1B4_1661 Agmatine deiminase (EC 3.5.3.12)

Query= reanno::pseudo5_N2C3_1:AO356_10030
         (368 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661 Agmatine deiminase
           (EC 3.5.3.12)
          Length = 368

 Score =  714 bits (1844), Expect = 0.0
 Identities = 335/366 (91%), Positives = 352/366 (96%)

Query: 1   MTTLHSTPRADGFHMPAEWATQTQVWMIWPERPDNWRLGGKPAQAAHVAVAKAIARFEPV 60
           MTTL+STPR DGF+MPAEWA QTQ WM+WPERPDNWRLGGKPAQAAHVAVAKAIARFEPV
Sbjct: 1   MTTLNSTPRTDGFYMPAEWAPQTQTWMVWPERPDNWRLGGKPAQAAHVAVAKAIARFEPV 60

Query: 61  TVAVSAAQYENARARLDVPNIRLVEMSSDDAWVRDTGPTFVINDSGEVRGVDWDFNAWGG 120
           TVAVSA QYENARARLDVPNIRLVEMSSDDAWVRDTGPTFVIN+ GEVRGVDWDFNAWGG
Sbjct: 61  TVAVSAGQYENARARLDVPNIRLVEMSSDDAWVRDTGPTFVINNRGEVRGVDWDFNAWGG 120

Query: 121 FDGGLYAPWNRDSQVASKVLEIERSPRYRTEGFVLEGGSIHVDGEGTVITTEECLLNRNR 180
           FDGGLY+PWNRDSQVA K+LEIERSPRYRTEGFVLEGGSIHVDGEGT+ITTEECLLNRNR
Sbjct: 121 FDGGLYSPWNRDSQVAGKILEIERSPRYRTEGFVLEGGSIHVDGEGTLITTEECLLNRNR 180

Query: 181 NPHMSREQIEAVLSAQLAVDKVIWLPDGLFNDETDGHVDNFCCYVRPGEVLLAWTDDPQN 240
           NPHM R QIEAVLSA LAVDK+IWLPDGLFNDETDGHVDNFCCYVRPGEVLLAWTDDPQ+
Sbjct: 181 NPHMDRAQIEAVLSANLAVDKIIWLPDGLFNDETDGHVDNFCCYVRPGEVLLAWTDDPQD 240

Query: 241 PNYTRCHAAMDVLQNSTDAKGRPFTVHKMPIPGPMYATEEECAGVDAVEGSQERNPTVRL 300
           PNY RC AAM+VLQNSTDAKGRPFTVHKMPIPGP+YATE+ECAGVD V+G+QERNPTVRL
Sbjct: 241 PNYPRCQAAMNVLQNSTDAKGRPFTVHKMPIPGPLYATEDECAGVDPVDGTQERNPTVRL 300

Query: 301 AGSYVNFLIVNGGIIAPSFDDPLDAPARDILQNLFPQHEVVMVPGRELLLGGGNIHCLTQ 360
           AGSYVNFLIVNGGIIAPSFDDPLD PA++ILQ LFPQHEVVMVPGRELLLGGGNIHCLTQ
Sbjct: 301 AGSYVNFLIVNGGIIAPSFDDPLDGPAKEILQALFPQHEVVMVPGRELLLGGGNIHCLTQ 360

Query: 361 QQPAPY 366
           QQPAP+
Sbjct: 361 QQPAPH 366


Lambda     K      H
   0.318    0.136    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 700
Number of extensions: 19
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 368
Length of database: 368
Length adjustment: 30
Effective length of query: 338
Effective length of database: 338
Effective search space:   114244
Effective search space used:   114244
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate Pf1N1B4_1661 (Agmatine deiminase (EC 3.5.3.12))
to HMM TIGR03380 (aguA: agmatine deiminase (EC 3.5.3.12))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03380.hmm
# target sequence database:        /tmp/gapView.32251.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03380  [M=357]
Accession:   TIGR03380
Description: agmatine_aguA: agmatine deiminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   7.1e-178  576.9   0.0   8.1e-178  576.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661  Agmatine deiminase (EC 3.5.3.12)


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661  Agmatine deiminase (EC 3.5.3.12)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  576.7   0.0  8.1e-178  8.1e-178       1     357 []       6     364 ..       6     364 .. 0.99

  Alignments for each domain:
  == domain 1  score: 576.7 bits;  conditional E-value: 8.1e-178
                                      TIGR03380   1 ttpkedgfrlPaefekqkevwliWPerpDnWregakpaqkafaevakaiakvepvtvlvskeqy 64 
                                                    +tp+ dgf++Pae+++q+++w++WPerpDnWr g+kpaq+a+++vakaia++epvtv+vs+ qy
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661   6 STPRTDGFYMPAEWAPQTQTWMVWPERPDNWRLGGKPAQAAHVAVAKAIARFEPVTVAVSAGQY 69 
                                                    58************************************************************** PP

                                      TIGR03380  65 enarkalpe.eirvvemssnDawirDvGPtfvvndkgelrgvdwefnawgglkdGlyfpWdkDd 127
                                                    enar++l+  +ir+vemss+Daw+rD+GPtfv+n++ge+rgvdw+fnawgg+++Gly+pW++D+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661  70 ENARARLDVpNIRLVEMSSDDAWVRDTGPTFVINNRGEVRGVDWDFNAWGGFDGGLYSPWNRDS 133
                                                    *******966****************************************************** PP

                                      TIGR03380 128 kvarkvleleridryra.dlvleggsihvDGeGtlltteeclLsegrnpelskeeieeklkeyl 190
                                                    +va k+le+er +ryr+  +vleggsihvDGeGtl+tteeclL+++rnp++ +++ie++l + l
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661 134 QVAGKILEIERSPRYRTeGFVLEGGSIHVDGEGTLITTEECLLNRNRNPHMDRAQIEAVLSANL 197
                                                    *****************89********************************************* PP

                                      TIGR03380 191 gvekviWlkeGlyldetnGhvDnllnfvrPGevvlswtddesdPqyeiskealevLenetDakG 254
                                                    +v+k+iWl++Gl++det+GhvDn++++vrPGev+l+wtdd +dP+y ++++a++vL+n+tDakG
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661 198 AVDKIIWLPDGLFNDETDGHVDNFCCYVRPGEVLLAWTDDPQDPNYPRCQAAMNVLQNSTDAKG 261
                                                    **************************************************************** PP

                                      TIGR03380 255 rklkvhklklpeplllteeeakgvdavegtlpreagerlaasyvnyliankaiilPlfddekDk 318
                                                    r ++vhk+++p+pl++te+e++gvd v+gt++r++  rla+syvn+li+n++ii+P+fdd+ D 
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661 262 RPFTVHKMPIPGPLYATEDECAGVDPVDGTQERNPTVRLAGSYVNFLIVNGGIIAPSFDDPLDG 325
                                                    **************************************************************** PP

                                      TIGR03380 319 eakkllqelfPdrkvvgvkareillgGGnihcitqqipa 357
                                                     ak++lq lfP+++vv+v+ re+llgGGnihc+tqq+pa
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1661 326 PAKEILQALFPQHEVVMVPGRELLLGGGNIHCLTQQQPA 364
                                                    *************************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (357 nodes)
Target sequences:                          1  (368 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.30
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory