GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aguB in Pseudomonas fluorescens FW300-N1B4

Align N-carbamoylputrescine amidase; Nitrilase-like protein 1; EC 3.5.1.53 (characterized)
to candidate Pf1N1B4_4326 N-carbamoylputrescine amidase (3.5.1.53)

Query= SwissProt::Q8VYF5
         (299 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326 N-carbamoylputrescine
           amidase (3.5.1.53)
          Length = 302

 Score =  329 bits (844), Expect = 4e-95
 Identities = 155/288 (53%), Positives = 208/288 (72%), Gaps = 1/288 (0%)

Query: 10  VVVSSLQFACSDDISTNVAAAERLVREAHAKGANIILIQELFEGYYFCQAQREDFFKRAK 69
           + +++ Q  C+ D+  N+  AERLVREA AKGA +IL+QELF   YFC  Q       A+
Sbjct: 4   LTIATTQMPCTWDLQHNLDQAERLVREAAAKGAQVILLQELFATPYFCIEQSHKHLALAE 63

Query: 70  PYKNHPTIARMQKLAKELGVVIPVSFFEEANTAHYNSIAIIDADGTDLGIYRKSHIPDGP 129
            Y++ P + R   LAKELGVV+P+S+FE+A  A++NS+++ DADG  LG+YRK+HIP+  
Sbjct: 64  EYRDSPVLKRFAALAKELGVVLPLSWFEKAGNAYFNSLSVADADGRLLGVYRKTHIPNAI 123

Query: 130 GYQEKFYFNPGDTGFKVFQTKFAKIGVAICWDQWFPEAARAMVLQGAEILFYPTAIGSEP 189
           GYQEK YF+PGDTGF+V+ T F +IGV ICWDQWFPE AR + L GAE+L +PTAIGSEP
Sbjct: 124 GYQEKEYFSPGDTGFRVWDTAFGRIGVGICWDQWFPETARCLALMGAEVLLFPTAIGSEP 183

Query: 190 QDQGLDSRDHWRRVMQGHAGANVVPLVASNRIGKEIIETEHGPSQITFYGTSFIAGPTGE 249
               LDSRDHW+  M+GHA AN++P+VA+NR+G E+  T+    Q+ FYG+SFI    G+
Sbjct: 184 GCAALDSRDHWQMTMRGHAAANILPVVAANRVGPEVATTD-PTLQMNFYGSSFICNHKGK 242

Query: 250 IVAEADDKSEAVLVAQFDLDMIKSKRQSWGVFRDRRPDLYKVLLTMDG 297
           ++AEAD  S  VLV   DL  ++ +R SWG++RDRRPD+Y  LL+ DG
Sbjct: 243 LLAEADRDSTGVLVHSLDLTAMREERLSWGIYRDRRPDMYGALLSQDG 290


Lambda     K      H
   0.321    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 287
Number of extensions: 7
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 299
Length of database: 302
Length adjustment: 27
Effective length of query: 272
Effective length of database: 275
Effective search space:    74800
Effective search space used:    74800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate Pf1N1B4_4326 (N-carbamoylputrescine amidase (3.5.1.53))
to HMM TIGR03381 (aguB: N-carbamoylputrescine amidase (EC 3.5.1.53))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03381.hmm
# target sequence database:        /tmp/gapView.8463.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03381  [M=279]
Accession:   TIGR03381
Description: agmatine_aguB: N-carbamoylputrescine amidase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   5.6e-141  454.7   0.0   6.5e-141  454.5   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326  N-carbamoylputrescine amidase (3


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326  N-carbamoylputrescine amidase (3.5.1.53)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  454.5   0.0  6.5e-141  6.5e-141       2     278 ..       5     284 ..       4     285 .. 0.98

  Alignments for each domain:
  == domain 1  score: 454.5 bits;  conditional E-value: 6.5e-141
                                      TIGR03381   2 kvaavqlalsedveeniekaeklvreaaakGaqiillpelfeapyfckeqeeeyfelakpveeh 65 
                                                    ++a++q+ +++d+++n+++ae+lvreaaakGaq+ill+elf++pyfc eq++++++la++++++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326   5 TIATTQMPCTWDLQHNLDQAERLVREAAAKGAQVILLQELFATPYFCIEQSHKHLALAEEYRDS 68 
                                                    89************************************************************** PP

                                      TIGR03381  66 plikrlqklakelevvlpvsffekagnalynslavidadGevlgvyrkshiPdgpgyeekfyfk 129
                                                    p++kr+++lakel+vvlp+s+fekagna++nsl v+dadG+ lgvyrk+hiP+++gy+ek yf+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326  69 PVLKRFAALAKELGVVLPLSWFEKAGNAYFNSLSVADADGRLLGVYRKTHIPNAIGYQEKEYFS 132
                                                    **************************************************************** PP

                                      TIGR03381 130 pGdtGfkvwdtryakiGvgicWdqWfpeaaralalkGaevllyPtaiGsePadaeldskehWqr 193
                                                    pGdtGf+vwdt++++iGvgicWdqWfpe+ar+lal+Gaevll+PtaiGseP  a+lds++hWq 
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326 133 PGDTGFRVWDTAFGRIGVGICWDQWFPETARCLALMGAEVLLFPTAIGSEPGCAALDSRDHWQM 196
                                                    **************************************************************** PP

                                      TIGR03381 194 amqGhaaanvvpvvaanrigkeveae...leltfyGssfiadetGelvaeadrseeavlvaefd 254
                                                    +m+Ghaaan++pvvaanr+g ev+++   l+++fyGssfi++++G+l+aeadr+ ++vlv+++d
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326 197 TMRGHAAANILPVVAANRVGPEVATTdptLQMNFYGSSFICNHKGKLLAEADRDSTGVLVHSLD 260
                                                    **********************87766669********************************** PP

                                      TIGR03381 255 ldeiakeraawGlfrdrrpelyek 278
                                                    l ++++er +wG++rdrrp++y +
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4326 261 LTAMREERLSWGIYRDRRPDMYGA 284
                                                    **********************86 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (279 nodes)
Target sequences:                          1  (302 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 9.19
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory