Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate Pf1N1B4_4910 Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4910 Length = 430 Score = 222 bits (565), Expect = 2e-62 Identities = 141/403 (34%), Positives = 206/403 (51%), Gaps = 34/403 (8%) Query: 27 RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWHTG-NGYTNEPVLR 85 R +GS LWD GK Y+DF GGI V +GH HP++V A+ Q K H +P L Sbjct: 33 RAQGSELWDVDGKRYLDFVGGIGVLNIGHNHPKVVAAVQAQLQKVSHACFQVVAYKPYLD 92 Query: 86 LAKQLIDATFADRVF---FCNSGAEANEAALKLARKYAHDRFGSEKSGIVAFKNAFHGRT 142 LA++L + + F SGAEA E A+K+AR + + +S ++AF+ FHGRT Sbjct: 93 LAQRLCEMIGGQESYKAAFFTSGAEAVENAVKIARAHTN------RSAVIAFRGGFHGRT 146 Query: 143 LF-TVSAGGQPAYSQDFAPLPPQIQHAIYNDL------DSAKALIDD---------NTCA 186 L T G Y Q+F P P++ H Y + D A +D+ A Sbjct: 147 LLGTTLTGMSQPYKQNFGPFAPEVFHTPYPNAYRGVTSDMALKALDELLATQVAPERVAA 206 Query: 187 VIVEPMQGEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPD 246 +I+EP+QG+GG + A +FL+ LR L H +LI DE+QTG GRTG+ + + H G+ PD Sbjct: 207 IIIEPVQGDGGFLSAPTEFLQALRALTAKHGIVLILDEIQTGFGRTGKWFGFQHAGIQPD 266 Query: 247 LLSTAKALGGGFPIGALLASERCASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLN 306 L++ AK+L GG P+ ++ G G TYGGN L+CA A V ++L Sbjct: 267 LVTVAKSLAGGLPLSGVVGKAEIMDAPLPGGLGGTYGGNALSCAAALAVIEAYEQEQLLA 326 Query: 307 GVKQRHQWFCERLNAINARYGLFKEIRGLGLLIGC-VLKDEYAGKAKAISNQ-----AAE 360 + + E L + ARY ++RG G ++ ++KD+ A A NQ A Sbjct: 327 RGEALGERLREGLLRLQARYPRIGDVRGSGFMLAIELIKDDDARTPDADLNQRLIDEARA 386 Query: 361 EGLMILIAGA--NVVRFAPALIISEDEVNSGLDRFELACKRFL 401 GL+++ G NV+RF L+ SE +V+ L + A R L Sbjct: 387 GGLLVIKCGVYRNVLRFLAPLVTSEAQVDEALQILDAALARVL 429 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 430 Length adjustment: 32 Effective length of query: 374 Effective length of database: 398 Effective search space: 148852 Effective search space used: 148852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory