Align BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate Pf1N1B4_4805 ABC transporter permease protein
Query= TCDB::P73544 (530 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4805 Length = 292 Score = 135 bits (339), Expect = 3e-36 Identities = 74/202 (36%), Positives = 116/202 (57%), Gaps = 9/202 (4%) Query: 313 GSILTVLLTAFSVFFGLIGGTGVAIALISDIKPLQLIFRIYVEFFRGTPMLVQLFIIYFG 372 G + T+++ ++ G++ G AI +S L+ + Y FRGTP+++QL +++F Sbjct: 75 GLLNTIVMAVLAMALGIVFGVITAIMRMSANPILRYVALTYTWLFRGTPLILQL-LLWFN 133 Query: 373 LPALFKEIGLGITIDR--------FPAAIIALSLNVAAYLAEIIRGGIQSIDQGQWEACE 424 L +F IG+ + F AA++ LS+N AY AE++R G+ S+D GQ+EA + Sbjct: 134 LALIFPTIGIPGLFEMDTVSLMTPFAAALLGLSINQGAYTAEVVRAGLLSVDTGQYEAAK 193 Query: 425 SLGMSPWQTMKEVIFPQAFRRILPPLGNEFITLIKDTSLTAVIGFQELFREGQLIVATTY 484 S+GM Q ++ +I PQA R I+PP+GNEFI ++K TSL +VI + EL Q I Sbjct: 194 SIGMPRLQALRRIILPQAMRIIIPPVGNEFIGMVKMTSLASVIQYSELLYNAQNIYYANA 253 Query: 485 RAFEVYIAVALVYLLLTTISSF 506 R E+ I + YL T+ SF Sbjct: 254 RVMELLIVAGIWYLATVTVLSF 275 Lambda K H 0.322 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 530 Length of database: 292 Length adjustment: 31 Effective length of query: 499 Effective length of database: 261 Effective search space: 130239 Effective search space used: 130239 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory