Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate Pf1N1B4_4794 Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4794 Length = 253 Score = 105 bits (262), Expect = 1e-27 Identities = 77/246 (31%), Positives = 124/246 (50%), Gaps = 24/246 (9%) Query: 15 LKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITFN 74 L VE+L +FG + S A+ GD+ ++IG +G+GK+T+ CI + G I + Sbjct: 4 LTVENLYKRFGDNEVLKGVSLNARAGDVVSMIGASGSGKSTMLRCINFLERADEGAIVLD 63 Query: 75 -----QKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASG 129 + G + P R+A FQ+ L+S LTVLEN+++A Sbjct: 64 GERVITRPGAGGMRVANPAQLQRLRTRLAMVFQHFNLWSHLTVLENIILAP--------- 114 Query: 130 YTILGLIGVGPYKREAAEAIELARFWLEKADLIDR-ADDPAGDLPYGAQRRLEIARAMCT 188 +LG+ R+AAE E AR +L+K L R AD L G Q+R+ IARA+ Sbjct: 115 CRVLGV------SRKAAE--ESARAYLDKVGLPQRVADQYPAFLSGGQQQRVAIARALAV 166 Query: 189 GPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYG 248 PE+L DEP + L+P + +++++ AE G ++L++ H+M ++S V+ L G Sbjct: 167 EPEILLFDEPTSALDPELVGEVLKVIQAL-AEEGRTMLMVTHEMGFARQVSSQVLFLHQG 225 Query: 249 QKISDG 254 + G Sbjct: 226 RVEEQG 231 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 253 Length adjustment: 25 Effective length of query: 267 Effective length of database: 228 Effective search space: 60876 Effective search space used: 60876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory