Align glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate Pf1N1B4_3024 4-aminobutyraldehyde dehydrogenase (EC 1.2.1.19)
Query= BRENDA::Q88RC0 (480 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3024 Length = 474 Score = 332 bits (850), Expect = 2e-95 Identities = 188/470 (40%), Positives = 276/470 (58%), Gaps = 14/470 (2%) Query: 15 INGEWLDADNGQTIKVTNPATGEVIGTVPKMGTAETRRAIEAADKALPAWRALTAKERSA 74 ING+ ++ D G V NPA G V+ + + A+ A+ AAD A AW T KERS Sbjct: 7 INGQLVNGD-GPAQAVFNPALGRVLVEINEASEAQVDAAVRAADNAFQAWSQTTPKERSL 65 Query: 75 KLRRWFELMIENQDDLARLMTTEQGKPLAEA-KGEIAYAASFIEWFAEEAK----RIYGD 129 L + +++ + ++LA+L + GKP + A EI A +FA + + G+ Sbjct: 66 LLLKLADIIEAHGEELAKLESDNCGKPYSAALNDEIPAIADVFRFFAGANRCMSGALGGE 125 Query: 130 TIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPYSA 189 +PGH ++ + P+GV A+I PWN+P M+ K PALAAG T+VLKP+ QTP +A Sbjct: 126 YLPGHTS----MIRRDPVGVIASIAPWNYPLMMVAWKIAPALAAGNTVVLKPSEQTPLTA 181 Query: 190 LALVELAHRAGIPAGVLSVVTGSAGEVGGELTGNSLVRKLSFTGSTEIGRQLMEECAKDI 249 L L ELA PAGVL++V G VG L + VR +S TGS G ++ A ++ Sbjct: 182 LRLAELASDI-FPAGVLNLVYGRGSAVGTALVNHPKVRMVSLTGSIATGSNIISSTAGNV 240 Query: 250 KKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRIYVQDGVYDAFAEKL 309 K++ +ELGG AP I+FDDAD+D AVEG + N GQ C A RIY Q G+YD F EKL Sbjct: 241 KRLHMELGGKAPVIIFDDADIDAAVEGIRTFGFYNAGQDCTAACRIYAQAGIYDQFVEKL 300 Query: 310 AAAVAKLKIGNGLEEGTTTGPLIDGKAVAKVQEHIEDAVSK-GAKVLSGGKLIEGN--FF 366 AAV+ +K G + T GPLI + +V +E A+++ ++++GGK +EGN FF Sbjct: 301 GAAVSSIKYGLQDDPSTELGPLISAQHRDRVTALVERAMAQPHIRLITGGKAVEGNGFFF 360 Query: 367 EPTILVDVPKTAAVAKEETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFYARDMSRVFR 426 EPT+L DV + + + E FGP+ + RF DEA+ +A +ND+++GLAS + D+ R R Sbjct: 361 EPTVLADVQQDDEIVRREVFGPVVSVTRFTDEAQALAWANDSDYGLASSVWTTDVGRAHR 420 Query: 427 VAEALEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYL 476 ++ L+YG +NT + P GG K SG G++ S YG+EDY ++++ Sbjct: 421 LSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSMYGLEDYTVVRHV 470 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 474 Length adjustment: 33 Effective length of query: 447 Effective length of database: 441 Effective search space: 197127 Effective search space used: 197127 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory