GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Pseudomonas fluorescens FW300-N1B4

Align 4-aminobutyrate transaminase subunit (EC 2.6.1.19) (characterized)
to candidate Pf1N1B4_1045 Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)

Query= metacyc::MONOMER-11537
         (425 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1045
           Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
           (EC 2.6.1.19)
          Length = 416

 Score =  358 bits (918), Expect = e-103
 Identities = 180/412 (43%), Positives = 263/412 (63%), Gaps = 4/412 (0%)

Query: 16  VPRGVGQIHPIFADSAKNATVTDVEGREFIDFAGGIAVLNTGHVHPKIIAAVTEQLNKLT 75
           + R +  +HP+     KNA V D +G+ +IDF GGI VLN GH HP+I+ A+ EQ  +LT
Sbjct: 6   ISRSINIVHPVTLSHGKNAEVWDTDGKRYIDFVGGIGVLNLGHCHPRIVEAIREQATRLT 65

Query: 76  HTCFQVLAYEPYVELCEKINAKVPGDFAKKTLLVTTGSEAVENAVKIARAATGRAGVIAF 135
           H  F    + PY+EL +++ A +P D+    +L  +G+EA ENA+KI R ATGR  VIAF
Sbjct: 66  HYAFNAAPHAPYLELMDRLTAFIPVDYPVSGMLTNSGAEAAENALKIVRGATGRTAVIAF 125

Query: 136 TGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVSIDDSIASIERIFKND 195
            GA+HGRT+ TL L GKV PY   +G++PG +F   +P++ + V+  +++ +++R+F  +
Sbjct: 126 DGAFHGRTLATLNLNGKVAPYKQKVGVLPGPVFHLPFPSKDNDVTCAEALKAMDRLFSVE 185

Query: 196 AEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIADEVQTGAGRTGTFFAM 255
            +  D+A  I+EPVQGE GF     EF + LR  CD  GILLIADE+Q+G GRTG  FA 
Sbjct: 186 IDVDDVACFIVEPVQGEAGFLAMDVEFAQALRRFCDDKGILLIADEIQSGFGRTGQRFAF 245

Query: 256 EQMGVTADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALAVMEV 315
            ++G+  DL    KSIAGG PL  V G+   +D +  GGLGGTY+G+PIACAAALA ++ 
Sbjct: 246 SRLGIEPDLILLGKSIAGGVPLGAVVGRKSLLDNLPKGGLGGTYSGNPIACAAALATLDE 305

Query: 316 FEEEHLLDRCKAVGERLVTGLKAIQAK--YPVIGEVRALGAMIAVELFENGDSHKPNAAA 373
             + HL        E +V+  ++ +A+   P +G +  +GAM  +EL  N D   P +A 
Sbjct: 306 MTDAHLHAWGVQQEEAIVSRYESWRARELSPYLGRLTGVGAMRGIELI-NADG-TPASAQ 363

Query: 374 VAQVVAKARDKGLILLSCGTYGNVLRVLVPLTSPDAQLDKGLAIIEECFAEL 425
           + Q++A ARD GL+L+  G   +++R+L PLT+  A L++GL I+E C A+L
Sbjct: 364 LTQLLALARDSGLLLMPSGKSRHIIRLLAPLTTEAAVLEEGLDILEACLAKL 415


Lambda     K      H
   0.320    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 464
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 425
Length of database: 416
Length adjustment: 32
Effective length of query: 393
Effective length of database: 384
Effective search space:   150912
Effective search space used:   150912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory