GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Pseudomonas fluorescens FW300-N1B4

Align 4-aminobutyrate transaminase subunit (EC 2.6.1.19) (characterized)
to candidate Pf1N1B4_1733 5-aminovalerate aminotransferase (EC 2.6.1.48) / Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)

Query= metacyc::MONOMER-11537
         (425 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733 5-aminovalerate
           aminotransferase (EC 2.6.1.48) /
           Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
           (EC 2.6.1.19)
          Length = 425

 Score =  820 bits (2119), Expect = 0.0
 Identities = 416/425 (97%), Positives = 421/425 (99%)

Query: 1   MSKTNASLMKRREAAVPRGVGQIHPIFADSAKNATVTDVEGREFIDFAGGIAVLNTGHVH 60
           MSKTNASLMKRREAAVPRGVGQIHPIFA+SAKNATVTDVEGREFIDFAGGIAVLNTGHVH
Sbjct: 1   MSKTNASLMKRREAAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH 60

Query: 61  PKIIAAVTEQLNKLTHTCFQVLAYEPYVELCEKINAKVPGDFAKKTLLVTTGSEAVENAV 120
           PKIIAAVTEQLNKLTHTCFQVLAYEPYVE+CEKINAKVPGDFAKKTLLVTTGSEAVEN++
Sbjct: 61  PKIIAAVTEQLNKLTHTCFQVLAYEPYVEVCEKINAKVPGDFAKKTLLVTTGSEAVENSI 120

Query: 121 KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS 180
           KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS
Sbjct: 121 KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS 180

Query: 181 IDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD 240
           IDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD
Sbjct: 181 IDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD 240

Query: 241 EVQTGAGRTGTFFAMEQMGVTADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA 300
           EVQTGAGRTGTFFAMEQMGV ADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
Sbjct: 241 EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA 300

Query: 301 GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVTGLKAIQAKYPVIGEVRALGAMIAVEL 360
           GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVTGLKAIQAKYPVIGEVRALGAMIAVEL
Sbjct: 301 GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVTGLKAIQAKYPVIGEVRALGAMIAVEL 360

Query: 361 FENGDSHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLRVLVPLTSPDAQLDKGLAIIEE 420
           F +GDSHKPNAAAVA VVAKARDKGLILLSCGTYGNVLRVLVPLTSPD QLDKGLAIIEE
Sbjct: 361 FVDGDSHKPNAAAVASVVAKARDKGLILLSCGTYGNVLRVLVPLTSPDEQLDKGLAIIEE 420

Query: 421 CFAEL 425
           CFAEL
Sbjct: 421 CFAEL 425


Lambda     K      H
   0.320    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 827
Number of extensions: 21
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 425
Length of database: 425
Length adjustment: 32
Effective length of query: 393
Effective length of database: 393
Effective search space:   154449
Effective search space used:   154449
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate Pf1N1B4_1733 (5-aminovalerate aminotransferase (EC 2.6.1.48) / Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19))
to HMM TIGR00700 (gabT: 4-aminobutyrate transaminase (EC 2.6.1.19))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00700.hmm
# target sequence database:        /tmp/gapView.20293.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00700  [M=420]
Accession:   TIGR00700
Description: GABAtrnsam: 4-aminobutyrate transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   8.8e-166  537.5   7.4     1e-165  537.4   7.4    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733  5-aminovalerate aminotransferase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733  5-aminovalerate aminotransferase (EC 2.6.1.48) / Gamma-aminobutyrate:a
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  537.4   7.4    1e-165    1e-165       1     418 [.      10     422 ..      10     424 .. 0.99

  Alignments for each domain:
  == domain 1  score: 537.4 bits;  conditional E-value: 1e-165
                                      TIGR00700   1 qrraaavskGvgvtlrvlaakaegaelkdvdGnrlidlaagiavlnvGhshPkvveavkrqvee 64 
                                                    +rr+aav++Gvg   +++a +a++a++ dv+G+++id+a+giavln+Gh hPk+++av +q+++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733  10 KRREAAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVHPKIIAAVTEQLNK 73 
                                                    69************************************************************** PP

                                      TIGR00700  65 lthtafqvvpyesyvelaeklnaiaPgsgekkavllnsGaeavenavkiarkytgrpgvvafsr 128
                                                    ltht+fqv+ ye yve+ ek+na  Pg   kk++l+++G+eaven++kiar+ tgr gv+af++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733  74 LTHTCFQVLAYEPYVEVCEKINAKVPGDFAKKTLLVTTGSEAVENSIKIARAATGRAGVIAFTG 137
                                                    **************************************************************** PP

                                      TIGR00700 129 gfhGrtnltmaltakvkPykiGfGPfapevyraPlpydyrdialdkqeslddelaaiealfvad 192
                                                    ++hGrt +t+ lt+kv Py  G+G +++ ++ra +p ++++ +       dd +a+ie++f+ d
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733 138 AYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVSI------DDSIASIERIFKND 195
                                                    ****************************************9877......88899********* PP

                                      TIGR00700 193 veaeqvaavvlePvqGeGGfivpakelvaavaslckehgivliadevqtGfartGklfaiehed 256
                                                     e++++aa+++ePvqGeGGf v++ke+++ ++ lc++hgi+liadevqtG  rtG++fa+e ++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733 196 AEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMG 259
                                                    **************************************************************** PP

                                      TIGR00700 257 dkPdlitvaksladGlPlsgvvGraeildapapGglGGtyaGnPlavaaalavldiieeeglie 320
                                                    +  dl t aks+a+G+Pl+gv G+ae +da apGglGGtyaG+P+a+aaalav+++ eee l +
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733 260 VAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALAVMEVFEEEHLLD 323
                                                    **************************************************************** PP

                                      TIGR00700 321 raeqigklvkdklielkeevpaigdvrglGamiavelv.dpdttePdaalaekiaaaalaaGll 383
                                                    r++ +g+++   l  ++++ p+ig+vr lGamiavel  d d+++P+aa  + + a+a+ +Gl+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733 324 RCKAVGERLVTGLKAIQAKYPVIGEVRALGAMIAVELFvDGDSHKPNAAAVASVVAKARDKGLI 387
                                                    ************************************866************************* PP

                                      TIGR00700 384 lltaGifGniirlltPltisdelldeglkileaal 418
                                                    ll++G +Gn++r+l Plt +de+ld+gl i+e+ +
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1733 388 LLSCGTYGNVLRVLVPLTSPDEQLDKGLAIIEECF 422
                                                    *******************************9876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (420 nodes)
Target sequences:                          1  (425 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 6.97
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory