Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate Pf1N1B4_4789 Butyryl-CoA dehydrogenase (EC 1.3.99.2)
Query= BRENDA::Q3JP94 (395 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4789 Length = 383 Score = 211 bits (537), Expect = 3e-59 Identities = 122/374 (32%), Positives = 202/374 (54%), Gaps = 2/374 (0%) Query: 15 DQQLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGG 74 D +L++++ M+RD A +A+G++AP + D + +MGE+GLLG +PE++GG Sbjct: 3 DIELSEEQVMIRDMARDFARGEIAPHAQAWEKAGWIDDGLVAKMGELGLLGMVVPEEWGG 62 Query: 75 PGLDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIG 134 +DYV+Y L E+ D ++MS+ +S+ P+ +G++ QK+++LP LA+G+ IG Sbjct: 63 TYVDYVAYALAVEEISAGDGATGALMSIHNSVGCGPVLNYGTEEQKQQWLPDLASGQAIG 122 Query: 135 CFGLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLD-EDGRDEI 193 CF LTEP GS+ ++ TRA G + ++G+K +++N A + +V+A D E G+ I Sbjct: 123 CFCLTEPQAGSEAHNLRTRAELRDGQWVINGAKQFVSNGKRAKLAIVFAVTDPELGKRGI 182 Query: 194 RGFILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLNS 252 F++ G K+G+RAS T + L+ VPE N+L KGL + L Sbjct: 183 SAFLVPTETAGFIVDRSEHKMGIRASDTCAVTLNNCTVPEANLLGERGKGLAIALSNLEG 242 Query: 253 ARYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLR 312 R GIA ALG A + + A Y DR QF +P+ +Q I LADM T + +L Sbjct: 243 GRIGIAAQALGIARAAFEAALAYARDRVQFDKPIIEHQSIANMLADMHTRLNAARLLILH 302 Query: 313 LGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNT 372 R++ G + S K + A + A + GG G +++ V R+ + + Sbjct: 303 AARLRSAGKPCLSEASQAKLFASEMAEKVCSSAIQIHGGYGYLEDYPVERYYRDARITQI 362 Query: 373 YEGTHDIHALILGR 386 YEG+ +I +++ R Sbjct: 363 YEGSSEIQRMVIAR 376 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 383 Length adjustment: 30 Effective length of query: 365 Effective length of database: 353 Effective search space: 128845 Effective search space used: 128845 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory