GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuA in Pseudomonas fluorescens FW300-N1B4

Align Glutamate--putrescine ligase (EC 6.3.1.11) (characterized)
to candidate Pf1N1B4_2256 glutamine synthetase family protein

Query= reanno::MR1:200446
         (451 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2256 glutamine synthetase
           family protein
          Length = 452

 Score =  685 bits (1768), Expect = 0.0
 Identities = 327/451 (72%), Positives = 384/451 (85%), Gaps = 3/451 (0%)

Query: 1   MNKLIAFLKERKITEVECVICDMTGIARGKIAPVDKFLDEKGMRLPESVLLQTVTGDFVD 60
           +++L  +LK+ KITEVEC+I D+TGI RGKI+P +KF+ EKGMRLPESVLLQTVTGD+V+
Sbjct: 5   LDQLTDWLKDHKITEVECMIGDLTGITRGKISPTNKFIAEKGMRLPESVLLQTVTGDYVE 64

Query: 61  DDIYYSLLDDADIDFVCVPDENAVFMLPWTIEATAQVIHDCYDRMGNPIELSPRNVLKKV 120
           DDIYY LLD ADID +C PD NAVF++PW IE TA VIHD YD+ GNPIELSPRNVLKKV
Sbjct: 65  DDIYYELLDPADIDMICRPDHNAVFLVPWAIEPTAIVIHDTYDKQGNPIELSPRNVLKKV 124

Query: 121 LSLYDEKGWEPVIAPEMEFYLTSRSDDHDLPLKPPIGRSGRPEAGRQSFSIDAANEYDPL 180
           L LY + GW+P++APEMEFYLT RSDD D PL+PPIGRSGRPE GRQSFSI+AANE+DPL
Sbjct: 125 LKLYADHGWQPIVAPEMEFYLTKRSDDPDYPLQPPIGRSGRPETGRQSFSIEAANEFDPL 184

Query: 181 FEDMYDWCEIQGLDIDTLIHEDGPAQMEINFSHGNPLSLADQVFVFKRTLREAALKHNVC 240
           FED+YDWCE+Q LD+DTLIHEDG AQMEINF HG+ LSLADQ+ VFKRT+REAALKHNV 
Sbjct: 185 FEDVYDWCELQELDLDTLIHEDGTAQMEINFRHGDALSLADQILVFKRTMREAALKHNVA 244

Query: 241 ATFMAKPVTDEPGSAMHIHQSVINKETGKNIFTNEDGTQSALFLSYIAGLQKYIPEFLPL 300
           ATFMAKP+T EPGSAMH+HQS+I+ ETGKN+F+NEDGT S LFL++I GLQK+IPE LPL
Sbjct: 245 ATFMAKPMTGEPGSAMHLHQSIISLETGKNVFSNEDGTMSQLFLNHIGGLQKFIPELLPL 304

Query: 301 MAPNANSFRRFLPGTSAPVNLEWGIENRTCGLRIPESSPQNRRIENRIPGADANCYLAFA 360
            APN NSFRRFLP TSAPVN+EWG ENRT GLR+P++ PQNRR+ENR+PGADAN YLA A
Sbjct: 305 FAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDAGPQNRRVENRLPGADANPYLAIA 364

Query: 361 AGLLCGYIGMVEGLKPSTPVQGKANESRSNNPHCLPLTLEEALVAMEESDACKEYLGESF 420
           A LLCG+IGMVEG  PS PV G+  E R+     LPLT+E+AL  ME S   ++YLG+ F
Sbjct: 365 ASLLCGFIGMVEGHNPSAPVVGRGYERRNLR---LPLTIEDALERMENSKTIEKYLGKKF 421

Query: 421 TTGFVAVKQAELENFRRVVSSWEREFLLLSV 451
            TG+VAVK+AE ENF+RV+SSWEREFLL +V
Sbjct: 422 ITGYVAVKRAEHENFKRVISSWEREFLLFAV 452


Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 727
Number of extensions: 22
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 451
Length of database: 452
Length adjustment: 33
Effective length of query: 418
Effective length of database: 419
Effective search space:   175142
Effective search space used:   175142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory