GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuB in Pseudomonas fluorescens FW300-N1B4

Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate Pf1N1B4_2141 Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)

Query= reanno::pseudo5_N2C3_1:AO356_21495
         (427 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2141
           Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)
          Length = 437

 Score =  379 bits (973), Expect = e-109
 Identities = 198/419 (47%), Positives = 266/419 (63%), Gaps = 4/419 (0%)

Query: 9   SYYAASANPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFKVTVLEAAKVGFGAS 68
           SYYAAS+ P P    L  ++  DVCV+G G++GL++AL L E GF V +LEA K+G+GAS
Sbjct: 17  SYYAASSLPQPDLAVLTGELVADVCVVGGGFSGLNTALELAERGFSVVLLEAHKIGWGAS 76

Query: 69  GRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCDLKDGGVF 128
           GRNGGQ++      +D     +G    + +  M  E   I+R+R+ ++QI CDL  G   
Sbjct: 77  GRNGGQLIRGVGHGLDQFANVIGADGVRQMKLMGLEAVEIVRQRIERFQIPCDLTWGYCD 136

Query: 129 AALTAKQM-GHLESQKRLWERFGHTQLELLDQRRIREVVACEEYVGGMLDMSGGHIHPLN 187
            A  A+ + G  E    L       +  LL    +  VV  + YVGG++DM  GH+HPLN
Sbjct: 137 LANKAQDLEGFAEDAIELHSLGYRYETRLLQAHEMHSVVGSDRYVGGLIDMGSGHLHPLN 196

Query: 188 LALGEAAAVESLGGVIYEQSPAVRIERGASPVVHTPQGKVRAKFIIVAGNAYLGNLVPEL 247
           LALGEAAA   LG  ++E+S   RI+ G    VHT QG VRAK +++  NAYL +L P+L
Sbjct: 197 LALGEAAAAGQLGVKLFERSAVTRIDYGPEVKVHTAQGTVRAKTLVLGCNAYLNDLNPQL 256

Query: 248 AAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFGGGVVYGA 307
             K +P G+ +IATEPL +E AH+LLPQ+  V D    LDYYRL+ D+RL+FGG   Y  
Sbjct: 257 GGKVLPAGSYIIATEPLSEEQAHALLPQNMAVCDQRVALDYYRLSADRRLLFGGACHYSG 316

Query: 308 RDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGD--NIYYSQGCS 365
           RDP +I A +RPKML  FPQL  VKIDY W G   +  +RLPQ+GRL +  N+YY+Q  S
Sbjct: 317 RDPKDIAAYMRPKMLAVFPQLAGVKIDYQWGGMIGIGANRLPQIGRLKEQPNVYYAQAYS 376

Query: 366 GHGVTYTHLAGKVLAEALRG-QAERFDAFADLPHYPFPGGQLLRTPFAAMGAWYYGLRD 423
           GHGV  THLAGK+LAEA+ G Q+  FD FA +PH  FPGG+ LR+P  A+G  ++ +++
Sbjct: 377 GHGVNATHLAGKLLAEAISGQQSGGFDLFAKVPHITFPGGRHLRSPLLALGMLWHRMKE 435


Lambda     K      H
   0.320    0.139    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 614
Number of extensions: 35
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 427
Length of database: 437
Length adjustment: 32
Effective length of query: 395
Effective length of database: 405
Effective search space:   159975
Effective search space used:   159975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory