GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuB in Pseudomonas fluorescens FW300-N1B4

Align Gamma-glutamylputrescine oxidoreductase; Gamma-Glu-Put oxidase; Gamma-glutamylputrescine oxidase; EC 1.4.3.- (characterized)
to candidate Pf1N1B4_4356 Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)

Query= SwissProt::P37906
         (426 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4356
           Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)
          Length = 432

 Score =  621 bits (1602), Expect = 0.0
 Identities = 292/424 (68%), Positives = 348/424 (82%)

Query: 3   EHTSSYYAASANKYAPFDTLNESITCDVCVVGGGYTGLSSALHLAEAGFDVVVLEASRIG 62
           +H +SYYAA+ N    F  L +++ CDVCV+G GYTGLSSAL L+EAG+ V VLEA+++G
Sbjct: 9   KHVNSYYAATRNFTGDFPVLEQAVDCDVCVIGAGYTGLSSALFLSEAGYSVTVLEAAKVG 68

Query: 63  FGASGRNGGQLVNSYSRDIDVIEKSYGMDTARMLGSMMFEGGEIIRERIKRYQIDCDYRP 122
           FGASGRNGGQLVNSYSRD+DVIE+ YG  TA +LGSM+FEG +IIR RIK Y I CDYRP
Sbjct: 69  FGASGRNGGQLVNSYSRDVDVIEERYGDKTAEVLGSMIFEGADIIRSRIKEYDIQCDYRP 128

Query: 123 GGLFVAMNDKQLATLEEQKENWERYGNKQLELLDANAIRREVASDRYTGALLDHSGGHIH 182
           GG+F A+N KQL  L EQK +WERYGNK L +LDA  I+REV  D Y G LLD  GGHIH
Sbjct: 129 GGIFAALNKKQLNGLAEQKSSWERYGNKNLRMLDAADIKREVGCDNYVGGLLDMQGGHIH 188

Query: 183 PLNLAIGEADAIRLNGGRVYELSAVTQIQHTTPAVVRTAKGQVTAKYVIVAGNAYLGDKV 242
           PLNLA+GEA AI   GG++YE SA  +I +  P  VRTAKG V AKY+++AGNAYL   +
Sbjct: 189 PLNLALGEAAAIIRLGGKIYEQSAAVEITYGEPITVRTAKGVVRAKYLLIAGNAYLPQDL 248

Query: 243 EPELAKRSMPCGTQVITTERLSEDLARSLIPKNYCVEDCNYLLDYYRLTADNRLLYGGGV 302
           +  + ++SMPCG+Q++ TE LSE +ARSLI  NYCVEDCNYLLDYYRLTADNRLLYGGGV
Sbjct: 249 DNRVTRKSMPCGSQIVVTEPLSEKVARSLIANNYCVEDCNYLLDYYRLTADNRLLYGGGV 308

Query: 303 VYGARDPDDVERLVVPKLLKTFPQLKGVKIDYRWTGNFLLTLSRMPQFGRLDTNIYYMQG 362
           VYGAR+PDD+E+L+ PK+LKTFPQLK VKIDYRWTGNFLLT+SRMPQFGR++ N YYMQG
Sbjct: 309 VYGAREPDDIEQLIRPKILKTFPQLKDVKIDYRWTGNFLLTMSRMPQFGRIEKNAYYMQG 368

Query: 363 YSGHGVTCTHLAGRLIAELLRGDAERFDAFANLPHYPFPGGRTLRVPFTAMGAAYYSLRD 422
           YSGHGVTC+HLAG+LI+E++RGDAERFDAFA+LPH P  GGRT + P TAMGAAYY+LRD
Sbjct: 369 YSGHGVTCSHLAGKLISEMIRGDAERFDAFASLPHMPMLGGRTFQAPLTAMGAAYYALRD 428

Query: 423 RLGV 426
           R G+
Sbjct: 429 RFGI 432


Lambda     K      H
   0.320    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 684
Number of extensions: 23
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 426
Length of database: 432
Length adjustment: 32
Effective length of query: 394
Effective length of database: 400
Effective search space:   157600
Effective search space used:   157600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory