Align Amino-acid permease RocE (characterized)
to candidate Pf1N1B4_1580 Histidine transport protein (permease)
Query= SwissProt::P39137 (467 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1580 Length = 469 Score = 300 bits (767), Expect = 9e-86 Identities = 152/453 (33%), Positives = 250/453 (55%), Gaps = 4/453 (0%) Query: 5 QDNGNQLQRTMKSRHLFMISLGGVIGTGFFLGTGFTINQAGPLGAVLSYLVGGFIMFLTM 64 Q L+R + +RH+ ++LG IGTG F G+ I AGP +L+YL+GG +F+ M Sbjct: 2 QQPAKGLKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGP-AVLLAYLIGGAAVFMVM 60 Query: 65 LCLGELAVAFPVSGSFQTYATKFISPAFGFAFGWLYWLGWAVTCAIEFLSAGQLMQRWFP 124 LGE+AV PV+GSF YA+ ++ P GF GW Y + + + G M WFP Sbjct: 61 RALGEMAVHNPVAGSFGQYASTYLGPMAGFILGWTYAFEMVIVGMADVTAFGIYMGFWFP 120 Query: 125 HIDVWIWCLVFAALMFILNAITTKAFAESEFWFSGIKILIILLFIILG-GAAMFGLIDLK 183 +D WIW L +++ LN K F E EFW S +K+ I+ I+ G G +FG+ Sbjct: 121 EVDRWIWVLGIVSVVGGLNLCNVKVFGEMEFWLSLLKVAAIVAMILGGFGIMLFGISTAP 180 Query: 184 GGEQAPFLTHFYEDGLFPNGIKAMLITMITVNFAFQGTELIGVAAGESEDPEKTIPRSIK 243 G + + G PNG+ ++ + V FAF G E+IGV AGE++DP++ +PR+I Sbjct: 181 GAQATDISNLWSHGGFMPNGVGGLIASFAVVMFAFGGIEIIGVTAGEAKDPQRVLPRAIN 240 Query: 244 QTVWRTLVFFVLSIIVIAGMIPWKQAGVVESPFVAVFEQIGIPYAADIMNFVILIALLSV 303 R L+F+VL+++V+ + PW+Q G SPFV +F+ +GI AA I+N V++ A +S Sbjct: 241 AVPLRILLFYVLTMLVLMSIFPWQQIGSQGSPFVQIFDNLGISSAATILNIVVISAAVSA 300 Query: 304 ANSGLYASTRILYAMANEGQAFKALGKTNQRGVPMYSLIVTMAVACLSLLTKFAQAETVY 363 NS ++ + R++Y +A +G A K + ++ GVP +++V + L +L + E V+ Sbjct: 301 INSDIFGAGRMMYGLAQQGHAPKGFARLSRNGVPWLTVVVMSSALLLGVLLNYLIPENVF 360 Query: 364 MVLLSLAGMSAQVGWITISLSQIMFRRKYIREGGKIEDLKFKTPLYPVLPLIGLTLNTVV 423 +++ S+A + W+ I +Q+ RR E ++ LKF P +P P+ + + Sbjct: 361 LLIASVATFATVWVWLMILFTQVAMRRSMSAE--QVAQLKFPVPFWPYAPMAAIAFMLFI 418 Query: 424 LISLAFDPEQRIALYCGVPFMIICYIIYHVVIK 456 L + P+ + AL GV ++++ + Y +K Sbjct: 419 FGVLGYFPDTQAALIVGVVWIVLLVLAYLTWVK 451 Lambda K H 0.329 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 467 Length of database: 469 Length adjustment: 33 Effective length of query: 434 Effective length of database: 436 Effective search space: 189224 Effective search space used: 189224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory