Align Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; EC 3.5.3.1; EC 3.5.3.11 (characterized)
to candidate Pf1N1B4_4717 Agmatinase (EC 3.5.3.11)
Query= SwissProt::P46637 (342 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 Length = 319 Score = 107 bits (268), Expect = 3e-28 Identities = 89/276 (32%), Positives = 131/276 (47%), Gaps = 25/276 (9%) Query: 69 GVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDVPVQEIRDC 128 GVP +S G F P IR A ST A E P + V + DC Sbjct: 49 GVPFDTATSNRPGARFGPRGIRAA----STGIAWERHW----PWTFDPFDHLAVIDYGDC 100 Query: 129 GVDDDRLMNVISESVKLVMEE---EPLRPLVLGGDHSISYPVVRAVSEKLGGPVDILHLD 185 D +V ES++ E L GGDH ISYP+++A + + GP+ ++H D Sbjct: 101 AFDYGTPQSV-PESIEAHAEHILSGGCAMLTFGGDHFISYPLLKAHARQ-HGPLSLIHFD 158 Query: 186 AHPDIYDCFEGNKYSHASSFARIMEGGYA--RRLLQVGIRSINQEGREQGKRFGVEQYEM 243 AH D + EG + H + F + G R +Q+G+R+ N + + G + + Sbjct: 159 AHSDTWPDEEGKRVDHGTMFWHAAKEGLVDPSRSVQIGLRTTNDDHQ------GFQVLDA 212 Query: 244 RTFSKD--RPMLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHN 301 R + ++E ++ G VY++ D+DCLDPAFAPG GGLS L IL Sbjct: 213 RQVHRQGCEAIVEAIRARVGDHPVYLTFDIDCLDPAFAPGTGTPVCGGLSTVQALEILGG 272 Query: 302 LQA-DVVGADVVEFNPQRDTVDGMTAMVAAKLVREL 336 L+ ++VG DVVE P D+ D +T++ AA L E+ Sbjct: 273 LRGINLVGMDVVEVAPAYDSAD-ITSLAAATLAMEM 307 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 319 Length adjustment: 28 Effective length of query: 314 Effective length of database: 291 Effective search space: 91374 Effective search space used: 91374 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory