Align Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 (characterized)
to candidate Pf1N1B4_4717 Agmatinase (EC 3.5.3.11)
Query= SwissProt::Q7X3P1 (306 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 Length = 319 Score = 325 bits (832), Expect = 1e-93 Identities = 158/280 (56%), Positives = 206/280 (73%), Gaps = 6/280 (2%) Query: 31 YSSD---ADWVITGVPFDMATSGRAGTRHGPGAIRQISTNLAWEGHRWPWHFDMRERLKV 87 YS D D V++GVPFD ATS R G R GP IR ST +AWE H WPW FD + L V Sbjct: 36 YSRDLRGVDVVVSGVPFDTATSNRPGARFGPRGIRAASTGIAWERH-WPWTFDPFDHLAV 94 Query: 88 VDCGDLVFNFGDAQDMSDKLQAHTEKLLAAGKRCLTFGGDHFVTLPLLRAHAKHFGKMAL 147 +D GD F++G Q + + ++AH E +L+ G LTFGGDHF++ PLL+AHA+ G ++L Sbjct: 95 IDYGDCAFDYGTPQSVPESIEAHAEHILSGGCAMLTFGGDHFISYPLLKAHARQHGPLSL 154 Query: 148 VHFDAHTDTYAN--GSKFDHGTMFYHAPNEGLIDPQHSVQIGIRTEHDTNNGFTVLDAAQ 205 +HFDAH+DT+ + G + DHGTMF+HA EGL+DP SVQIG+RT +D + GF VLDA Q Sbjct: 155 IHFDAHSDTWPDEEGKRVDHGTMFWHAAKEGLVDPSRSVQIGLRTTNDDHQGFQVLDARQ 214 Query: 206 VNDRGVDDLVAQIKEIVGSLPVYLTFDIDCLDPAFAPGTGTPVVGGLTTDKALKMLRALQ 265 V+ +G + +V I+ VG PVYLTFDIDCLDPAFAPGTGTPV GGL+T +AL++L L+ Sbjct: 215 VHRQGCEAIVEAIRARVGDHPVYLTFDIDCLDPAFAPGTGTPVCGGLSTVQALEILGGLR 274 Query: 266 PLNIVGMDLVEVSPAYDQSDITALAGATIALDMLYLQAAK 305 +N+VGMD+VEV+PAYD +DIT+LA AT+A++ML L AK Sbjct: 275 GINLVGMDVVEVAPAYDSADITSLAAATLAMEMLCLYVAK 314 Lambda K H 0.321 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 319 Length adjustment: 27 Effective length of query: 279 Effective length of database: 292 Effective search space: 81468 Effective search space used: 81468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate Pf1N1B4_4717 (Agmatinase (EC 3.5.3.11))
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.24963.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-78 247.7 0.0 1e-77 247.5 0.0 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 Agmatinase (EC 3.5.3.11) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 Agmatinase (EC 3.5.3.11) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 247.5 0.0 1e-77 1e-77 13 274 .. 43 309 .. 30 310 .. 0.93 Alignments for each domain: == domain 1 score: 247.5 bits; conditional E-value: 1e-77 TIGR01230 13 AevvivgiPydattsyrpGsrhgpeaireastnLeayseeldrdlal...lkvvDagdlplaaG 73 +vv+ g+P+d++ts rpG+r+gp ir ast+++++ + ++ ++ l v+D gd + +G lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 43 VDVVVSGVPFDTATSNRPGARFGPRGIRAASTGIAWERH-WPWTFDPfdhLAVIDYGDCAFDYG 105 699********************************9865.5665554444************** PP TIGR01230 74 daremvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlr..... 132 ++ + e+ie+++e++l g ++++GG+H+i++p+++A+++++++l +++fDAH D+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 106 TPQSVPESIEAHAEHILSGGCAMLTFGGDHFISYPLLKAHARQHGPLSLIHFDAHSDTWpdeeg 169 **********************************************************976666 PP TIGR01230 133 defegeklshacvmrrvlelglnvlqigiRsgikeeadlarennikvlkreledeiaevlakvl 196 +++++++ +++++++++ +++qig+R+ ++ +++ + ++ +v + e + a+v lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 170 KRVDHGTMFWHAAKEGLVDPS-RSVQIGLRTTNDDHQGFQVLDARQVHRQGCEAIVEAIRARVG 232 668888899999999999999.9************************9999999999999**** PP TIGR01230 197 dkpvyvtiDiDvlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssev 260 d+pvy+t+DiD+lDPafaPG+gtp+ gGl++ ++l+ + + ++vG+DvvEvaP+yds+++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 233 DHPVYLTFDIDCLDPAFAPGTGTPVCGGLSTVQALE-ILGGLRGINLVGMDVVEVAPAYDSADI 295 ************************************.67788999******************* PP TIGR01230 261 taltaaklalelll 274 t l+aa+la+e+l lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4717 296 TSLAAATLAMEMLC 309 ************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (319 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.36 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory