GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ans in Pseudomonas fluorescens FW300-N1B4

Align Glutaminase-asparaginase; L-ASNase/L-GLNase; L-asparagine/L-glutamine amidohydrolase; EC 3.5.1.38 (characterized)
to candidate Pf1N1B4_6037 L-asparaginase (EC 3.5.1.1)

Query= SwissProt::O68897
         (362 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037 L-asparaginase (EC
           3.5.1.1)
          Length = 362

 Score =  660 bits (1702), Expect = 0.0
 Identities = 341/362 (94%), Positives = 347/362 (95%)

Query: 1   MKSALKTFVPGALALLLLFPVAAQAKEVETKTKLANVVILATGGTIAGAGASAANSATYQ 60
           MKSA  TF+PGALALLLL P A QAKEVETK KLANVVILATGGTIAGAGASAANSATYQ
Sbjct: 1   MKSAFNTFIPGALALLLLLPTALQAKEVETKQKLANVVILATGGTIAGAGASAANSATYQ 60

Query: 61  AAKVGIEQLIAGVPELSQIANVRGEQVMQIASESINNENLLQLGRRVAELADSKDVDGIV 120
           AAKVGIEQLIAGVPELSQ+ANVRGEQVMQIASESI N+NLLQLGRRVAELADSKDVDGIV
Sbjct: 61  AAKVGIEQLIAGVPELSQLANVRGEQVMQIASESITNDNLLQLGRRVAELADSKDVDGIV 120

Query: 121 ITHGTDTLEETAYFLNLVEKTDKPIIVVGSMRPGTAMSADGMLNLYNAVAVAGSKDARGK 180
           ITHGTDTLEETAYFLNLVEKTDKPIIVVGSMRPGTAMSADGMLNLYNAVAVA SKDARGK
Sbjct: 121 ITHGTDTLEETAYFLNLVEKTDKPIIVVGSMRPGTAMSADGMLNLYNAVAVASSKDARGK 180

Query: 181 GVLVTMNDEIQSGRDVSKMINIKTEAFKSPWGPLGMVVEGKSYWFRLPAKRHTMDSEFDI 240
           GVLVTMNDEIQSGRDVSKMINIKTEAFKS WGPLGMVVEGKSYWFRLPAKRHTMDSEFDI
Sbjct: 181 GVLVTMNDEIQSGRDVSKMINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTMDSEFDI 240

Query: 241 KTIKSLPDVEIAYGYGNVSDTAVKALAQAGAKAIIHAGTGNGSVSSKVVPALQELRKQGV 300
           KTIKSL DVEIAY YGNVSDTA KALAQ+GAKAIIHAGTGNGSVSS+VVPALQ LRK GV
Sbjct: 241 KTIKSLADVEIAYSYGNVSDTAYKALAQSGAKAIIHAGTGNGSVSSRVVPALQALRKDGV 300

Query: 301 QIIRSSHVNAGGFVLRNAEQPDDKYDWVVAHDLNPQKARILAMVALTKTQDSKELQRMFW 360
           QIIRSSHVNAGGFVLRNAEQPDDKYDWVVA+DLNPQKARILAMVALTKT DSKELQRMFW
Sbjct: 301 QIIRSSHVNAGGFVLRNAEQPDDKYDWVVANDLNPQKARILAMVALTKTNDSKELQRMFW 360

Query: 361 EY 362
           EY
Sbjct: 361 EY 362


Lambda     K      H
   0.315    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 445
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 362
Length adjustment: 29
Effective length of query: 333
Effective length of database: 333
Effective search space:   110889
Effective search space used:   110889
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 49 (23.5 bits)

Align candidate Pf1N1B4_6037 (L-asparaginase (EC 3.5.1.1))
to HMM TIGR00520 (L-asparaginase, type II (EC 3.5.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00520.hmm
# target sequence database:        /tmp/gapView.22467.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00520  [M=352]
Accession:   TIGR00520
Description: asnASE_II: L-asparaginase, type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   1.3e-121  391.7   3.2   1.5e-121  391.5   3.2    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037  L-asparaginase (EC 3.5.1.1)


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037  L-asparaginase (EC 3.5.1.1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  391.5   3.2  1.5e-121  1.5e-121      16     352 .]      26     362 .]      14     362 .] 0.96

  Alignments for each domain:
  == domain 1  score: 391.5 bits;  conditional E-value: 1.5e-121
                                      TIGR00520  16 vsaakaksLPnikilatGGtiagkgqssastaeYkvgklgvedLieavPelkeianiegeqivn 79 
                                                     +++ +++L n+ ilatGGtiag+g+s a+ a Y++ k+g+e+Li  vPel+++an++geq+++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037  26 KEVETKQKLANVVILATGGTIAGAGASAANSATYQAAKVGIEQLIAGVPELSQLANVRGEQVMQ 89 
                                                    34556899******************************************************** PP

                                      TIGR00520  80 vgsqdlneevllklakrisealasddvdGivithGtDtleetayfldltvksdkPvvlvGamRp 143
                                                    + s+++ ++ ll+l +r+ e  +s+dvdGivithGtDtleetayfl+l+ k+dkP+++vG+mRp
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037  90 IASESITNDNLLQLGRRVAELADSKDVDGIVITHGTDTLEETAYFLNLVEKTDKPIIVVGSMRP 153
                                                    **************************************************************** PP

                                      TIGR00520 144 atsvsaDGplnLYnavsvaadeksagrGvlvvlndrilsarevtktnttsldtfkseeqGalGy 207
                                                     t++saDG lnLYnav+va++++++g+Gvlv++nd+i s+r+v k+   ++++fks   G lG 
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037 154 GTAMSADGMLNLYNAVAVASSKDARGKGVLVTMNDEIQSGRDVSKMINIKTEAFKSA-WGPLGM 216
                                                    ********************************************************9.****** PP

                                      TIGR00520 208 iandkieyerepvkkhtletefdvskldeplPkvdiiYayqnlpeelvkavvdagakGivlagv 271
                                                    ++++k ++ r p+k+ht+++efd++  ++ l +v+i Y+y n++++  ka++++gak i+ ag+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037 217 VVEGKSYWFRLPAKRHTMDSEFDIKTIKS-LADVEIAYSYGNVSDTAYKALAQSGAKAIIHAGT 279
                                                    *****************************.********************************** PP

                                      TIGR00520 272 GnGslsaaalkvleeaakesvvivrssRvadG.vvt.kdaevddkealiasgtLnPqkaRvLLq 333
                                                    GnGs+s  ++ +l+ + k++v i+rss v+ G  v  +++++ddk++ + ++ LnPqkaR+L +
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037 280 GNGSVSSRVVPALQALRKDGVQIIRSSHVNAGgFVLrNAEQPDDKYDWVVANDLNPQKARILAM 343
                                                    *****************************9873444155678999******************* PP

                                      TIGR00520 334 LaLtktkdlekiqevfeey 352
                                                    +aLtkt+d +++q++f ey
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6037 344 VALTKTNDSKELQRMFWEY 362
                                                    ****************887 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (352 nodes)
Target sequences:                          1  (362 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 6.78
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory