Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate Pf1N1B4_1711 ABC-type polar amino acid transport system, ATPase component
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1711 Length = 260 Score = 232 bits (592), Expect = 5e-66 Identities = 119/239 (49%), Positives = 165/239 (69%), Gaps = 2/239 (0%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEV-V 59 +IE K NK++G VL I+L VK GE +VI+GPSG GKST +RC+NGLE SG + Sbjct: 4 LIEFKGFNKFFGEQQVLDGIDLQVKPGEVIVILGPSGCGKSTLLRCLNGLEVAHSGSLNF 63 Query: 60 VNNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKY 119 +L+ R+ MVFQ ++L+PHM+VL NL L P+K+QK+ ++EA A Sbjct: 64 AGRELLDKGTDWREVRQQIGMVFQSYHLFPHMSVLDNLLLGPLKVQKRERREARAQAEAL 123 Query: 120 LKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMK 179 L+ VGLLDK +P LSGGQQQR+AI RSLC +LFDE T+ALDPE ++EVL+V++ Sbjct: 124 LERVGLLDKREAFPRQLSGGQQQRIAIVRSLCMNPKVMLFDEVTAALDPEMVKEVLEVIQ 183 Query: 180 EISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLGK 238 ++ + T+++VTHEM FA+ VADRI+FM+ G I+E++ P FF+NP+T RA+ FL K Sbjct: 184 GLARE-GMTLLIVTHEMAFARAVADRIVFMDAGRILEQHPPEIFFTNPQTARAQQFLEK 241 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 260 Length adjustment: 24 Effective length of query: 218 Effective length of database: 236 Effective search space: 51448 Effective search space used: 51448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory