Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate Pf1N1B4_4805 ABC transporter permease protein
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4805 Length = 292 Score = 108 bits (270), Expect = 1e-28 Identities = 71/229 (31%), Positives = 127/229 (55%), Gaps = 7/229 (3%) Query: 3 EFDWSSIVPSLPY--LLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYV 60 + +WS I L ++ GL+ T+ + V A+ +GI++G + A+MR+S+ + + A Y Sbjct: 57 KIEWSYIGQFLTSQAIMWGLLNTIVMAVLAMALGIVFGVITAIMRMSANPILRYVALTYT 116 Query: 61 NVFRSIPLVM-VLLWFYLIVPGFLQNVLGLSPKNDIRLIS----AMVAFSMFEAAYYSEI 115 +FR PL++ +LLWF L + + GL + + L++ A++ S+ + AY +E+ Sbjct: 117 WLFRGTPLILQLLLWFNLALIFPTIGIPGLFEMDTVSLMTPFAAALLGLSINQGAYTAEV 176 Query: 116 IRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVL 175 +RAG+ S+ GQ AA ++GM Q+++ IILPQA R ++P + + I + + TSL V+ Sbjct: 177 VRAGLLSVDTGQYEAAKSIGMPRLQALRRIILPQAMRIIIPPVGNEFIGMVKMTSLASVI 236 Query: 176 SLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA 224 ++ A I + +E+++ AG Y S S L+RR A Sbjct: 237 QYSELLYNAQNIYYANARVMELLIVAGIWYLATVTVLSFGQSRLERRFA 285 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 292 Length adjustment: 24 Effective length of query: 200 Effective length of database: 268 Effective search space: 53600 Effective search space used: 53600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory