Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate Pf1N1B4_5104 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5104 Length = 324 Score = 178 bits (452), Expect = 1e-49 Identities = 122/326 (37%), Positives = 173/326 (53%), Gaps = 20/326 (6%) Query: 5 LLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLT 64 +LK E + + + V VD LSF++ E EV+G+VGESG GKT + + P Sbjct: 1 VLKVEELSVIVRKGEHEVTLVDRLSFDLAEGEVLGLVGESGSGKTLACRGLMRLLPSPN- 59 Query: 65 LVDGKIFLRVNGEFVELSS---MTRDEV-KRKFWGKEITIIPQAAMNALMPTIRMEKYVR 120 LRV G V+L+ + DE R+ G+++ +I Q + L P +R+ + + Sbjct: 60 -------LRVEGTAVQLAGENLLHLDEAGMRRMRGRQLGMIFQNPSSHLDPLMRIGEQIG 112 Query: 121 HLAESH-GIDEEELLDKARRRFEEVGL-DPLW-IKRYPFELSGGMRQRAVIAIATILNPS 177 H G E +A +VG+ DP + YP E SGGMRQRA+IA+A NP+ Sbjct: 113 EGIRLHQGASRREARAQAIDVLRQVGIPDPQRRVDSYPHEFSGGMRQRAMIAVALGCNPN 172 Query: 178 LLIADEPTSALDVVNQKVLLKVLMQMKRQ-GIVKSIIFITHDIATVRQIADRMIIMYAGK 236 +LIADEPT+ALDV Q +L++L+ ++ Q G+ SII ITHD+ V Q D + +MYAG+ Sbjct: 173 VLIADEPTTALDVTVQAQILRLLLDLRDQRGL--SIIMITHDLGVVAQTCDSIAVMYAGR 230 Query: 237 IVEFAPVESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPR 296 + E +L P HPYT GL + P + TI G PP L P GCRF+PR Sbjct: 231 LCEHGNKHEVLAHPRHPYTAGLID--CQPATSHGHALLNTIAGQPPLLDALPQGCRFNPR 288 Query: 297 CPHAMDVCKEKEPPLTEIEPGRRVAC 322 C + C P L + G R+AC Sbjct: 289 CQQIGNRCTTLMPGLQPVSHGHRIAC 314 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 324 Length adjustment: 28 Effective length of query: 302 Effective length of database: 296 Effective search space: 89392 Effective search space used: 89392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory