GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gtsC in Pseudomonas fluorescens FW300-N1B4

Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate Pf1N1B4_5114 Maltose/maltodextrin ABC transporter, permease protein MalG

Query= TCDB::Q72KX4
         (268 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5114 Maltose/maltodextrin
           ABC transporter, permease protein MalG
          Length = 280

 Score =  139 bits (351), Expect = 5e-38
 Identities = 85/273 (31%), Positives = 144/273 (52%), Gaps = 10/273 (3%)

Query: 1   MGRALLYGFLLLMAGFFLLPVYLVVLTALKEPARITLETVWQWPHPPYWESFRTAWE--A 58
           +G   L G LLL A F   P Y  ++T+LK  +   L  V  W   P + ++       +
Sbjct: 13  LGFWCLIGVLLLYAVF---PFYYAIVTSLKPSS--ALFEVSYWIENPDFSNYAAVLNQAS 67

Query: 59  FRPKFQNSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSILIPL 118
           F     NS+V+A+    L+  +     Y L +  FRG G +  ++L     P  ++L  L
Sbjct: 68  FLRAIGNSLVVALCVVTLALFLSLTAAYALGRVKFRGRGTVLMMVLGVSMFPQVAVLSGL 127

Query: 119 FQFMKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFFGIFRH 178
           F+ ++++GLY + + L+L + I+ +P    +   +  ++P EL EAA +DGA  +     
Sbjct: 128 FEVIRALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTR 187

Query: 179 VILPLSVPAFVVVAIWQFTQIWNEFLFAVTLTRPESQ-PITVALAQLAGG--EAVKWNLP 235
           V+LPL  PA V   +  F   WNEFLFA+T T  ++Q  + VA+A ++GG    + W L 
Sbjct: 188 VLLPLLWPALVTTGLLAFIAAWNEFLFALTFTLTDTQRTVPVAIALISGGSPHELPWGLL 247

Query: 236 MAGAILAALPTLLVYILLGRYFLRGLLAGSVKG 268
           MA +++  +P +++ ++  R  + GL AG++KG
Sbjct: 248 MAASVVVTVPLVILVLIFQRRIVSGLTAGALKG 280


Lambda     K      H
   0.330    0.146    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 232
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 268
Length of database: 280
Length adjustment: 25
Effective length of query: 243
Effective length of database: 255
Effective search space:    61965
Effective search space used:    61965
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory