GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mglA in Pseudomonas fluorescens FW300-N1B4

Align Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized)
to candidate Pf1N1B4_4286 Inositol transport system ATP-binding protein

Query= TCDB::P0AAG8
         (506 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4286 Inositol transport
           system ATP-binding protein
          Length = 526

 Score =  464 bits (1194), Expect = e-135
 Identities = 238/501 (47%), Positives = 344/501 (68%), Gaps = 4/501 (0%)

Query: 4   STTPSSGEYLLEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFGIY 63
           + TP    YLLE+  ++K FPGV AL +V L+VRP S+ ALMGENGAGKSTL+K + GIY
Sbjct: 23  TATPVDEPYLLEIINVSKGFPGVVALSDVQLRVRPGSVLALMGENGAGKSTLMKIIAGIY 82

Query: 64  QKDSGTILFQGKEIDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKGM-FVD 122
           Q D+G +  +GK + F +   AL+ GI+M+HQELNL+   S+ +N+W+GR    G+  +D
Sbjct: 83  QPDAGELRLRGKPVVFETPLAALQAGIAMIHQELNLMPHMSIAENIWIGREQLNGLHMID 142

Query: 123 QDKMYRETKAIFDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTE 182
             +M+R T  + + L I++DP   VG LS+++ QM+EIAKA SY++ I+IMDEPTS++T+
Sbjct: 143 HREMHRCTAKLLERLRINLDPEELVGNLSIAERQMVEIAKAVSYDSDILIMDEPTSAITD 202

Query: 183 KEVNHLFTIIRKLKERGCGIVYISHKMEEIFQLCDEVTVLRDGQWIATEPLAGLTMDKII 242
           KEV HLF+II  LK +G GI+YI+HKM E+F + DEV V RDG +I  +    +  D +I
Sbjct: 203 KEVAHLFSIIADLKRQGKGIIYITHKMNEVFSIADEVAVFRDGAYIGLQRADSMDGDSLI 262

Query: 243 AMMVGRSLNQRFPDKENKPGEVILEVRNLTSLRQPSIRDVSFDLHKGEILGIAGLVGAKR 302
           +MMVGR L+Q FP +E   G+++L VR+L        +DVSFDLH GEILGIAGL+G+ R
Sbjct: 263 SMMVGRELSQLFPVREKPIGDLLLSVRDLK--LDGIFKDVSFDLHAGEILGIAGLMGSGR 320

Query: 303 TDIVETLFGIREKSAGTITLHGKQINNHNANEAINHGFALVTEERRSTGIYAYLDIGFNS 362
           T++ E +FGI     G I L G+ +   + + AI  GFAL+TE+R+ +G++  L +  N 
Sbjct: 321 TNVAEAIFGITPSDGGEIRLDGEVVRISDPHMAIEKGFALLTEDRKLSGLFPCLSVLENM 380

Query: 363 LISNIRNYKNKVGLLDNSRMKSDTQWVIDSMRVKTPGHRTQIGSLSGGNQQKVIIGRWLL 422
            ++ + +Y    G +    +++  + +   +RVKTP     I +LSGGNQQK ++ RWL+
Sbjct: 381 EMAVLPHYVGN-GFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQQKALLARWLM 439

Query: 423 TQPEILMLDEPTRGIDVGAKFEIYQLIAELAKKGKGIIIISSEMPELLGITDRILVMSNG 482
           T P IL+LDEPTRGIDVGAK EIY+LI+ LA +G  +I+ISSE+PE+LG++DR++VM  G
Sbjct: 440 TNPRILILDEPTRGIDVGAKAEIYRLISYLASEGMAVIMISSELPEVLGMSDRVMVMHEG 499

Query: 483 LVSGIVDTKTTTQNEILRLAS 503
            + G +D    TQ  +++LAS
Sbjct: 500 DLMGTLDRSEATQERVMQLAS 520



 Score = 71.6 bits (174), Expect = 6e-17
 Identities = 50/225 (22%), Positives = 103/225 (45%), Gaps = 6/225 (2%)

Query: 31  NVNLKVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGTILFQGKEIDFHSAKEALENGI 90
           +V+  +    I  + G  G+G++ + + +FGI   D G I   G+ +       A+E G 
Sbjct: 299 DVSFDLHAGEILGIAGLMGSGRTNVAEAIFGITPSDGGEIRLDGEVVRISDPHMAIEKGF 358

Query: 91  SMVHQELNL---VLQRSVMDNMWLGRYP--TKGMFVDQDKMYRETKAIFDELDIDIDPRA 145
           +++ ++  L       SV++NM +   P      F+ Q  +    + +  +L +      
Sbjct: 359 ALLTEDRKLSGLFPCLSVLENMEMAVLPHYVGNGFIQQKALRALCEDMCKKLRVKTPSLE 418

Query: 146 R-VGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFTIIRKLKERGCGIVY 204
           + + TLS    Q   +A+    N +I+I+DEPT  +       ++ +I  L   G  ++ 
Sbjct: 419 QCIDTLSGGNQQKALLARWLMTNPRILILDEPTRGIDVGAKAEIYRLISYLASEGMAVIM 478

Query: 205 ISHKMEEIFQLCDEVTVLRDGQWIATEPLAGLTMDKIIAMMVGRS 249
           IS ++ E+  + D V V+ +G  + T   +  T ++++ +  G S
Sbjct: 479 ISSELPEVLGMSDRVMVMHEGDLMGTLDRSEATQERVMQLASGMS 523


Lambda     K      H
   0.318    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 653
Number of extensions: 28
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 506
Length of database: 526
Length adjustment: 35
Effective length of query: 471
Effective length of database: 491
Effective search space:   231261
Effective search space used:   231261
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory