Align Citrate:H+ symporter (characterized)
to candidate Pf1N1B4_2033 L-Proline/Glycine betaine transporter ProP
Query= TCDB::P16482 (444 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2033 Length = 432 Score = 206 bits (525), Expect = 9e-58 Identities = 127/415 (30%), Positives = 216/415 (52%), Gaps = 31/415 (7%) Query: 36 GNFLEQFDFFLFGFYATYIAHTFFPASS-EFASLMMTFAVFGAGFLMRPIGAIVLGAYID 94 G LE +DF +F F+AT + FFPA E+ LM TF +F AG+L RP+G IV+ + D Sbjct: 32 GGALEFYDFIIFVFFATVVGKLFFPADMPEWLRLMQTFGIFAAGYLARPLGGIVMAHFGD 91 Query: 95 KVGRRKGLIVTLSIMATGTFLIVLIPSYQTIGLWAPLLVLIGRLLQGFSAGAELGGVSVY 154 +GR+K +++ +MA T ++ L+P+Y IG+WAP+L+L+ R++QG + G E+ G V+ Sbjct: 92 LLGRKKMFTLSIFMMAVPTLIMGLLPTYAQIGMWAPILLLLMRVIQGAAIGGEVPGAWVF 151 Query: 155 LAEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFALNAVLEPSAISDWGWRIPFLFGVLIV 214 ++E G+ + I++ + + A+N++ P +SD+ WRIPFL G + Sbjct: 152 VSEHVPQRHIGYACGTLTSGLTAGILLGSLVATAINSIYTPVEVSDYAWRIPFLLGGVFG 211 Query: 215 PFIFILRRKLEETQEFTARRHHLAMRQ--------------VFATLLANWQVVIAGMMMV 260 F LRR L ET F + A+ + + ++L W + A ++++ Sbjct: 212 LFSVYLRRWLHETPVFAELQLRKALAEEVPLRAVLRDHRGAILISMLLTWLLSAAIVVLI 271 Query: 261 AMTTTAFYLITVYAPTFGKKVLMLSASDSLLVTLLVAISNFFWLPVGGALSDRFGRRSVL 320 MT T + +APT + S+S+ + LL + GAL+DRFG V Sbjct: 272 LMTPTVLQTVYHFAPTTALQ------SNSVAIVLL-----SIGCIIAGALADRFGAGRVF 320 Query: 321 IAMTLLALATAWPALTMLANAPSFLMMLSVLLWLSFIYGMYNGAMIPALTEIMPAEVRVA 380 + L ++W LA P +L + + L + G GA+ + + P VR + Sbjct: 321 VFGCAALLVSSWTFYHSLAEHPDWLFPMYAITGL--LVGTI-GAVPYVMVKAFPPVVRFS 377 Query: 381 GFSLAYSLATAVFGGFTPVISTALIEYTGDKASPGYWMSFAAICGLLATCYLYRR 435 G S +Y++A A+FGG TP+I + L++ + P Y+++ G+L YL+++ Sbjct: 378 GLSFSYNVAYAIFGGLTPMIVSLLLKES--PMGPAYYVAVLCGVGILVGAYLWKK 430 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 432 Length adjustment: 32 Effective length of query: 412 Effective length of database: 400 Effective search space: 164800 Effective search space used: 164800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory