Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate Pf1N1B4_1640 Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1640 Length = 257 Score = 329 bits (843), Expect = 4e-95 Identities = 162/249 (65%), Positives = 206/249 (82%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 LE+++LHKRYG EVLKG+SL A GDVISI+GSSGSGKSTFLRCINLLE PH G+IL+ Sbjct: 8 LEIRNLHKRYGQLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQILVA 67 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 EELKL A K+G L AAD KQ+ R+RS + VFQ+FNLW HM+ ++NI+EAP VLG SK Sbjct: 68 GEELKLKAAKNGELVAADGKQINRLRSEIGFVFQNFNLWPHMSVLDNIIEAPRRVLGQSK 127 Query: 124 AEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 AEA E AE LAKVG++ ++ AYP +SGG+QQR AIAR LAM+P+V+LFDEPTSALDPE Sbjct: 128 AEAIEVAEALLAKVGIADKRHAYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSALDPE 187 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 +V +VL V++ALA+EGRTM++VTHEM FAR+VS+++VFLH+G+VEE G+P++V NP S Sbjct: 188 MVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGSPQQVFENPLSA 247 Query: 244 RLQQFLSGS 252 R +QF+S + Sbjct: 248 RCKQFMSSN 256 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory