Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate Pf1N1B4_5844 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5844 Length = 259 Score = 181 bits (459), Expect = 1e-50 Identities = 99/255 (38%), Positives = 145/255 (56%), Gaps = 4/255 (1%) Query: 5 RSLFAALLLPLCA-TAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLE 63 R +F AL L + + TA A + K IR G+ YPPF DG L GFD+++G+A+C +++ Sbjct: 4 RVMFGALALSMLSLTAMADDAKPIRLGIEAGYPPFSMKNPDGKLTGFDVDIGDALCEQMK 63 Query: 64 VKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADF 123 VKCTWV EFDG+IPAL+ +K DAI+SSM +T R+K +DF+ + + +P + ++ D Sbjct: 64 VKCTWVEQEFDGLIPALKVKKIDAILSSMTITDDRKKNVDFTIKYYHTPARFVMKEGTDV 123 Query: 124 GDTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDK 183 D L GK+VGVL+ S + +A L G + Y SQ + D+ GRLDA L D Sbjct: 124 KDPLTELKGKKVGVLRASTHDRFATEVLVPAGINLVRYGSQQEANLDMVAGRLDAMLADS 183 Query: 184 LEAQLNFLSKPEGSDFK-TGPAFKDPT-LPLDIAMGLRKNDQALRALINKGIAAVQADGT 241 + FL G F GP ++D + +RK D+ L N I ++A+G Sbjct: 184 VNLDDGFLKTDAGKGFAFVGPTYEDAKYFGGGAGIAVRKGDKELADKFNTAITEIRANGK 243 Query: 242 YAQIQKKYFGDQDIY 256 Y Q+Q KYF + D+Y Sbjct: 244 YKQVQDKYF-NFDVY 257 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory