Align arginine deiminase (EC 3.5.3.6) (characterized)
to candidate Pf1N1B4_4796 hypothetical protein
Query= reanno::pseudo3_N2E3:AO353_25635 (311 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4796 Length = 317 Score = 538 bits (1385), Expect = e-158 Identities = 263/309 (85%), Positives = 283/309 (91%) Query: 1 MQTTNTVLMIRPTRFSFNQDTAANNRFQRPAAAAEDVQLKALQEFDGYVAALREHGVEVM 60 MQTTNTVLMIRPTRFSFNQDTAANNRFQRPA +EDVQLKALQEFDGYVAALR HGVEV+ Sbjct: 1 MQTTNTVLMIRPTRFSFNQDTAANNRFQRPADVSEDVQLKALQEFDGYVAALRSHGVEVL 60 Query: 61 VHNDSEAPHTPDSIFPNNWWSSHPDGTLVLYPMQGHNRRLERDKGVLDWLRDAYRIEQLL 120 VHND EAPHTPDSIFPNNWWSSHPDGTLVLYPMQGHNRRLERDKGVLDWLRD YR+EQLL Sbjct: 61 VHNDLEAPHTPDSIFPNNWWSSHPDGTLVLYPMQGHNRRLERDKGVLDWLRDEYRVEQLL 120 Query: 121 DLSDLEQQEVFLEGTGSMVLDREQRICYAGYSTRTHAKALDQVVEHLGYELCAFNAVDRH 180 DLS LEQQEVFLEGTGSMVLDR+QR+CYAGYSTRTHA+ALDQ+V+HLGYELCAFNAVDR Sbjct: 121 DLSSLEQQEVFLEGTGSMVLDRQQRVCYAGYSTRTHARALDQLVDHLGYELCAFNAVDRQ 180 Query: 181 GVPIYHTNVMMSVGRQLAVVCLESVSDLDERNALRSRLECSGKQVLTLSFDQLESFAGNM 240 GV IYHTNVMMSVG QLA+ CL SV+ ER ALR RLE SGK+V+ L + QLESFAGNM Sbjct: 181 GVAIYHTNVMMSVGTQLAIACLASVTHPGERLALRKRLEDSGKKVIALDWAQLESFAGNM 240 Query: 241 LEVHNAAGEPLLVMSRTAWRSLHADQRRMVEAYAKPLPVNIDTIERIGGGSARCMLAEVY 300 LEVHNAAGEPLLVMSRTAW+SL ADQRR++EA+ PLPVNIDTIERIGGGSARCMLAEV+ Sbjct: 241 LEVHNAAGEPLLVMSRTAWQSLDADQRRLIEAHTTPLPVNIDTIERIGGGSARCMLAEVF 300 Query: 301 LPKRVSPQE 309 L KR S ++ Sbjct: 301 LSKRQSKRQ 309 Lambda K H 0.320 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 317 Length adjustment: 27 Effective length of query: 284 Effective length of database: 290 Effective search space: 82360 Effective search space used: 82360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory