GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupA in Pseudomonas fluorescens FW300-N1B4

Align Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate Pf1N1B4_1243 ABC transporter ATP-binding protein

Query= TCDB::A2RKA7
         (506 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1243 ABC transporter
           ATP-binding protein
          Length = 521

 Score =  340 bits (873), Expect = 6e-98
 Identities = 193/499 (38%), Positives = 295/499 (59%), Gaps = 8/499 (1%)

Query: 7   IQMIDVTKRFGDFVANDKVNLELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVHVK 66
           +Q+  ++KR+   +AND ++L +  GEIHALLGENGAGKSTLM I+ G+     GE+  +
Sbjct: 14  LQLRRISKRYPGCLANDAIDLSIAPGEIHALLGENGAGKSTLMKIIYGVTHADSGEMIWQ 73

Query: 67  GKLENIDSPSKAANLGIGMVHQHFMLVDAFTVTENIILGNEVTKGINLDLKTAKKKILEL 126
           G+   + +P++A  LGIGMV QHF L +  +V +NI L      G     K  + KI E+
Sbjct: 74  GQRVTMRNPAQARGLGIGMVFQHFSLFETLSVAQNIALAMGAAAGTP---KQLEPKIREV 130

Query: 127 SERYGLSVEPDALIRDISVGQQQRVEILKTLYRGADILIFDEPTAVLTPAEITELMQIMK 186
           S+RYG+++EP+ L+  +S+G++QRVEI++ L +   +LI DEPT+VLTP E  EL   ++
Sbjct: 131 SQRYGMALEPERLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPQEADELFVTLR 190

Query: 187 NLIKEGKSIILITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVGRSVSFI 246
            L  EG SI+ I+HKL E+RA+    TV+R G+          ++++LA+LMVG +   I
Sbjct: 191 RLAAEGCSILFISHKLGEVRALCHSATVLRGGRVAGHCVPAQCSDRQLAQLMVGEAAELI 250

Query: 247 TEKAAAQPKDVVLEIKDLN-IKESRGSLKVKGLSLDVRAGEIVGVAGIDGNGQTELVKAI 305
           T+       D  L +  L+          +K +  DVR+GEIVGVAG+ GNGQ EL+  +
Sbjct: 251 TDYPKVMGADAFLSVTGLSWHNPDPFGCSLKNIDFDVRSGEIVGVAGVAGNGQDELLALL 310

Query: 306 TG---LTKVDSGSIKLHNKDITNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIALQT 362
           +G   L + DS +I    + + + RP    +  +  VP +R   G V E+++A+N AL T
Sbjct: 311 SGEERLPRDDSATISFGGQPVAHLRPDARRKLGLAFVPAERLGHGAVPELSLADN-ALLT 369

Query: 363 YYKPPMSKYGFLDYNKINSHARELMEEFDVRGAGEWVSASSLSGGNQQKAIIAREIDRNP 422
            ++  +  +G +   K+ + A +++  F V+       A SLSGGN QK I+ REI + P
Sbjct: 370 AFQQGLVSHGLVQRGKVQALAEDIIRRFGVKTPDSLAPARSLSGGNLQKFILGREILQQP 429

Query: 423 DLLIVSQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDGQIQ 482
            LL+ + PT G+DVGA   IH+ LI  RD G A+LVIS +LDE+  + DR+  +  GQ+ 
Sbjct: 430 KLLVAAHPTWGVDVGAAATIHRALIALRDAGAAILVISEDLDELFQICDRLGALCGGQLS 489

Query: 483 GIVSPETTTKQELGILMVG 501
            + +   T   ++G  M G
Sbjct: 490 PLQATVDTHLSDVGGWMAG 508


Lambda     K      H
   0.315    0.135    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 620
Number of extensions: 25
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 506
Length of database: 521
Length adjustment: 35
Effective length of query: 471
Effective length of database: 486
Effective search space:   228906
Effective search space used:   228906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory