Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate Pf1N1B4_4556 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4556 Length = 235 Score = 126 bits (316), Expect = 5e-34 Identities = 70/197 (35%), Positives = 111/197 (56%), Gaps = 6/197 (3%) Query: 64 ADVSDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFY 123 AD++D A + + ++LG +D+L+N+AG+ EDLD W + I NLN FY Sbjct: 41 ADIADLASLQVLFKTLATRLGYVDVLVNSAGVCDENEP-EDLD--NWHKVISVNLNGTFY 97 Query: 124 FLRKAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVR 183 +PL+ + II M+S+ GR G T Y ASK I+G+ K+LA++L P + Sbjct: 98 VTSLCLPLMADRGR---IINMSSILGRAGKVRNTAYCASKHGIIGLTKALAMDLAPRQIT 154 Query: 184 VNAILPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLAS 243 VNAILP ++ + ++A+A GI +Q+ +K+ LRR + +VAAM +LAS Sbjct: 155 VNAILPAWIDTPMLQGELAAQARIAGISQEQILRNAKKKLPLRRFIQGDEVAAMVRYLAS 214 Query: 244 PAGQNISGQAISVDGNV 260 P ++ Q++ +DG V Sbjct: 215 PEAGGVTAQSLMIDGGV 231 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 235 Length adjustment: 24 Effective length of query: 239 Effective length of database: 211 Effective search space: 50429 Effective search space used: 50429 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory