GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Pseudomonas fluorescens FW300-N1B4

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate Pf1N1B4_1734 Succinate-semialdehyde dehydrogenase [NAD(P)+] (EC 1.2.1.16)

Query= BRENDA::P51650
         (523 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1734
           Succinate-semialdehyde dehydrogenase [NAD(P)+] (EC
           1.2.1.16)
          Length = 480

 Score =  538 bits (1386), Expect = e-157
 Identities = 264/478 (55%), Positives = 357/478 (74%), Gaps = 8/478 (1%)

Query: 46  LLRGDSFVGGRWLPTP--ATFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFSSWKEI 103
           L R  +F+ G W+      T  V +PA+G  LGTV   G  E R A+ AA  A  +W+ +
Sbjct: 8   LFRQQAFIDGAWVDADNGQTIKVNNPATGEILGTVPKMGAAETRRAIEAADKALPAWRGL 67

Query: 104 SVKERSSLLRKWYDLMIQNKDELAKIITAESGKPLKEAQGEILYSAFFLEWFSEEARRVY 163
           + KER++ LR+W++L+I+N+D+LA+++T E GKPL EA+GEI+Y+A F+EWF+EEA+RVY
Sbjct: 68  TAKERANKLRRWFELIIENQDDLARLMTLEQGKPLAEAKGEIVYAASFIEWFAEEAKRVY 127

Query: 164 GDIIYTSAKDKRGLVLKQPVGVASIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPY 223
           GD+I     DKR +V+KQP+GV + ITPWNFP+AMITRK G ALAAGCT+V+KPA  TP+
Sbjct: 128 GDVIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPF 187

Query: 224 SALALAQLANQAGIPPGVYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKILLHH 283
           SA ALA+LA +AGIP GV++V+  S   A ++G  L  +P+V K+SFTGST  G+ L+  
Sbjct: 188 SAFALAELAQRAGIPNGVFSVVTGS---AGDIGSELTGNPIVRKLSFTGSTEIGRQLMTE 244

Query: 284 AANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDS 343
            A  +K+VS+ELGG APFIVFD A++D+AV GA+ SK+RN GQTCVC+NR  +Q  ++D+
Sbjct: 245 CAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRLYIQDSVYDA 304

Query: 344 FVTKFAEAMKKSLRVGNGFEEGTTQGPLINEKAVEKVEKHVNDAVAKGATVVTGGKRHQS 403
           F  K   A+ K L++GNG E+GTT GPLI+EKAV KV++H+ DAV KGATV+ GGK  Q 
Sbjct: 305 FAEKLKVAVAK-LKIGNGLEDGTTTGPLIDEKAVAKVQEHIADAVGKGATVLAGGKSMQ- 362

Query: 404 GGNFFEPTLLSNVTRDMLCITEETFGPVAPVIKFDKEEEAVAIANAADVGLAGYFYSQDP 463
            GNFFEPT+L+NV  +     EETFGP+AP+ +F  E + +A++N  + GLA YFY++D 
Sbjct: 363 -GNFFEPTILTNVPNNAAVAKEETFGPLAPLFRFKDEADVIAMSNDTEFGLASYFYARDL 421

Query: 464 AQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYG 521
            +++RVAE LE GMVGVN GLIS+   PFGG+K SGLGREGSKYGI++YLE+KY+C G
Sbjct: 422 GRVFRVAEALEYGMVGVNTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLCLG 479


Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 616
Number of extensions: 17
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 523
Length of database: 480
Length adjustment: 34
Effective length of query: 489
Effective length of database: 446
Effective search space:   218094
Effective search space used:   218094
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory