GapMind for catabolism of small carbon sources

 

Aligments for a candidate for frcA in Pseudomonas fluorescens FW300-N1B4

Align ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale)
to candidate Pf1N1B4_6034 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

Query= uniprot:A0A0C4Y5F6
         (540 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6034 Ribose ABC transport
           system, ATP-binding protein RbsA (TC 3.A.1.2.1)
          Length = 517

 Score =  307 bits (786), Expect = 7e-88
 Identities = 189/484 (39%), Positives = 282/484 (58%), Gaps = 17/484 (3%)

Query: 13  LLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGAYTADPGGECH 72
           +L++  I KT+     L  ++LT   GEV AL GENGAGKSTL KI+ G   A   G+  
Sbjct: 9   VLSVSGIGKTY-AQPVLTGIDLTLMRGEVLALTGENGAGKSTLSKIIGGL-VAPTTGQMR 66

Query: 73  IDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRRGLVARGDMVRACA 132
             G+  +      A +LG+ ++ QEL+L P LSVAEN++L       G ++R  + +A  
Sbjct: 67  FQGRDYRPGSRSQAEELGIRMVMQELNLLPTLSVAENLFLDNLPSHGGWISRKQLRKAAI 126

Query: 133 PTLARLGAD-FSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLSTHETDRLFA 191
             +A++G D   P   V  L I  +Q+VEIAR +  +  +L++DEPT  L+  E + LF 
Sbjct: 127 EAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVEMLFE 186

Query: 192 LIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALVKMMVGRDL 251
            I +L+  G++I+YISHR+ E+  +A R+ VLRDG  V     A+ +   LV +MVGR+L
Sbjct: 187 QITRLQARGVSIIYISHRLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVTLMVGREL 246

Query: 252 SGFYTKTHGQAVEREV---MLSVRDVADGRRVKGCSFDLRAGEVLGLAGLVGAGRTELAR 308
                  H     R++    L+V+ +    +V+  SF++RAGE+ G++GL+GAGRTEL R
Sbjct: 247 G-----EHIDMGPRKIGAPALTVKGLTRSDKVRDVSFEVRAGEIFGISGLIGAGRTELLR 301

Query: 309 LVFGADARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLTEDRKLQGLFLDQSVHE 368
           L+FGAD    G V +     S  +V++ +  P  A+  GIA +TEDRK +GL L QS+  
Sbjct: 302 LIFGADTADSGTVAL---GASAQVVSIRS--PADAVGHGIALITEDRKGEGLLLTQSISA 356

Query: 369 NINLIVAARDALGLGRLNRTAARRRTTEAIDTLGIRVAHAQVNVGALSGGNQQKVMLSRL 428
           NI L      + G G +N           I+ + IR +     V  LSGGNQQKV++ R 
Sbjct: 357 NIALGNMPVISSG-GFVNNGDEMSLAQRQINAMRIRSSSPTQLVSELSGGNQQKVVIGRW 415

Query: 429 LEIQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISSELPEVVGLCDRVLVMR 488
           LE    V++ DEPTRG+D+GAK +IY L+  L + G A++++SS+L E++ +CDR+ V+ 
Sbjct: 416 LERDCTVMLFDEPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLS 475

Query: 489 EGTL 492
            G L
Sbjct: 476 AGRL 479



 Score = 85.5 bits (210), Expect = 4e-21
 Identities = 71/248 (28%), Positives = 116/248 (46%), Gaps = 11/248 (4%)

Query: 3   DMSDTSTKAPLLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGA 62
           DM      AP L ++ + ++      +R V     AGE+  + G  GAG++ L++++ GA
Sbjct: 251 DMGPRKIGAPALTVKGLTRS----DKVRDVSFEVRAGEIFGISGLIGAGRTELLRLIFGA 306

Query: 63  YTADPGGEC-HIDGQRVQIDGPQSARDLGVAVIYQELS---LAPNLSVAENIYLGR--AL 116
            TAD G        Q V I  P  A   G+A+I ++     L    S++ NI LG    +
Sbjct: 307 DTADSGTVALGASAQVVSIRSPADAVGHGIALITEDRKGEGLLLTQSISANIALGNMPVI 366

Query: 117 QRRGLVARGD-MVRACAPTLARLGADFSPAANVASLSIAQRQLVEIARAVHFEARILVMD 175
              G V  GD M  A     A      SP   V+ LS   +Q V I R +  +  +++ D
Sbjct: 367 SSGGFVNNGDEMSLAQRQINAMRIRSSSPTQLVSELSGGNQQKVVIGRWLERDCTVMLFD 426

Query: 176 EPTTPLSTHETDRLFALIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRA 235
           EPT  +       ++AL+ +L  +G A++ +S  + E+  + DR+ VL  G  + T +R 
Sbjct: 427 EPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGRLIDTFERD 486

Query: 236 HLSQAALV 243
             +Q  L+
Sbjct: 487 SWTQDDLL 494


Lambda     K      H
   0.320    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 644
Number of extensions: 38
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 540
Length of database: 517
Length adjustment: 35
Effective length of query: 505
Effective length of database: 482
Effective search space:   243410
Effective search space used:   243410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory