Align Fructose-specific PTS system, I, HPr, and IIA components (characterized)
to candidate Pf1N1B4_2284 FIG001592: Phosphocarrier protein kinase/phosphorylase, nitrogen regulation associated
Query= reanno::pseudo3_N2E3:AO353_05485 (953 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2284 Length = 759 Score = 336 bits (861), Expect = 4e-96 Identities = 205/561 (36%), Positives = 319/561 (56%), Gaps = 16/561 (2%) Query: 405 VAAAPGIAIGPAHIQVLQA-IDYPLRGESTAIERER--LKTSLADVRRDIEGLIQRSKAK 461 V +PG A+G A + + A +D T I E KT++ VR D+ L + + Sbjct: 181 VPGSPGAAVGTAVVMLPPADLDVVPDKTITDINAELGLFKTAIEGVRADMRALSAKLATQ 240 Query: 462 AI---REIFITHQEMLDDPELTDEVDTRLKQGESAEAAWMAVIDAAARQQESLQDALLAE 518 R +F + MLDD L E+ T +K G+ A+ A V+ + E + DA L E Sbjct: 241 LRPEERALFDVYLMMLDDASLGSEITTVIKTGQWAQGALRQVVTEHVNRFELMDDAYLRE 300 Query: 519 RAADLRDIGRRVLAQLCGI--ETPSEPDQPYILVMDEVGPSDVARLDPTRVAGILTARGG 576 RA+D++D+GRR+LA L +T PD ILV +E+ P+ + + ++ G+++ G Sbjct: 301 RASDVKDLGRRLLAYLQEERQQTLVYPDNT-ILVSEELTPAMLGEVPEGKLVGLVSVLGS 359 Query: 577 ATAHSAIVARALGIPALVGAGAAVLRLASGTPLLLDGQRGRLHVDADAATLQRAAEERDN 636 +H AI+ARA+GIP ++G G +++DG G ++ + ++ AE + Sbjct: 360 GNSHVAILARAMGIPTVMGLVDLPYSKVDGIQMIVDGYHGEVYTNPSDVLRKQFAEVVEE 419 Query: 637 REQRLQAAAAQRHQPALTTDGHAVEVFANIGESAGVVSAVEQGAEGIGLLRTELIFMAHQ 696 +Q A R P +T DGH + ++ N G A V A ++GAEG+GL RTE+ FM +Q Sbjct: 420 EKQLALGLDALRDLPCVTVDGHRMPLWVNTGLLADVARAQKRGAEGVGLYRTEVPFMINQ 479 Query: 697 QAPDEATQEVEYRRVLDGLAGRPLVVRTLDVGGDKPLPYWPIAKEENPFLGVRGIRLTLQ 756 + P E Q YR L +P+ +R+LD+GGDK L Y+PI KE+NPFLG RGIR+TL Sbjct: 480 RFPSEKEQLAIYREQLAAFHPQPVTMRSLDIGGDKALSYFPI-KEDNPFLGWRGIRVTLD 538 Query: 757 RPQIMEAQLRALLRAADN-RPLRIMFPMVGSVDEWRQARDMTERLRLEI-----PVADLQ 810 P+I Q RA+L+A++ LRI+ PM+ + E +A + R E+ V Sbjct: 539 HPEIFLVQTRAMLKASEGLNNLRILLPMISGIHELEEALHLIHRAWGEVRDEGTDVPMPP 598 Query: 811 LGIMIEVPSAALLAPVLAKEVDFFSVGTNDLTQYTLAIDRGHPTLSAQADGLHPAVLQLI 870 +G+MIE+P+A LA++VDF SVG+NDLTQY LA+DR +P ++ D LHPAVLQ + Sbjct: 599 VGVMIEIPAAVYQTRELARQVDFLSVGSNDLTQYLLAVDRNNPRVADLYDYLHPAVLQAL 658 Query: 871 DITVRAAHAHGKWVGVCGELAADPLAVPVLVGLGVDELSVSARSIGEVKARVRELSLAQV 930 VR AHA GK V +CGE+A DP A +L+ +G D LS++A ++ +VK +R+++L++ Sbjct: 659 QNVVRDAHAEGKPVSICGEMAGDPAAAVLLMAMGFDSLSMNATNLPKVKWMLRQINLSKA 718 Query: 931 KHLAQLALAVGSANEVRALVE 951 K L + + + + + ++ Sbjct: 719 KELLAELMTIDNPQVIHSSLQ 739 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1367 Number of extensions: 63 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 953 Length of database: 759 Length adjustment: 42 Effective length of query: 911 Effective length of database: 717 Effective search space: 653187 Effective search space used: 653187 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (26.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory