Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate Pf1N1B4_4287 Inositol transport system permease protein
Query= uniprot:A0A161GM94 (322 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4287 Length = 340 Score = 176 bits (445), Expect = 9e-49 Identities = 108/332 (32%), Positives = 180/332 (54%), Gaps = 23/332 (6%) Query: 9 PTARKPLDLRRFLDDWVMLLAAIGI---FVLCTLMIDNFLSPLNMRGLGLAI---STTGI 62 P A RRF + + L IGI F + ++ + +N + L L I S G+ Sbjct: 9 PAAVPVKSRRRFPTELSIFLVLIGIGLVFEMFGWIVRDQSFLMNSQRLVLMILQVSIIGL 68 Query: 63 AACTMLYCLASGHFDLSVGSVIACAGVVAAVVMRDTN------------SVFLGISAALV 110 A + + + DLS GSV+A + ++AA + + ++ V++ + L Sbjct: 69 LAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVWIPVIVGLG 128 Query: 111 MGLIVGLINGIVIAKLRVNALITTLATMQIVRGLAYIFANGKAVGVSQESFFVFGNGQMF 170 +GL+ G ING +IA + I TL M RGLA + G+ V + +S+ G+G M Sbjct: 129 VGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYTAIGHGAM- 187 Query: 171 GVPVPILITIVCFLFFGWLLNYTTYGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGVI 230 P++I +V + F L YT YG+ T AIGGN +AA +G+NV R +I++++ G++ Sbjct: 188 ----PVIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIAGLL 243 Query: 231 GALAGVILASRMTSGQPMIGQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLILAIIEN 290 LAGV+ ++R +GQ +G +EL I+A V+GG SL+GG+G I + G LIL ++ + Sbjct: 244 AGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGVMAS 303 Query: 291 AMNLKNIDTFYQYVIRGSILLLAVVIDRLKQR 322 +D + Q +I+G I+++AVVID+ + + Sbjct: 304 GFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNK 335 Lambda K H 0.330 0.144 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 340 Length adjustment: 28 Effective length of query: 294 Effective length of database: 312 Effective search space: 91728 Effective search space used: 91728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory