GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mglA in Pseudomonas fluorescens FW300-N1B4

Align Galactose/methyl galactoside import ATP-binding protein MglA; EC 7.5.2.11 (characterized)
to candidate Pf1N1B4_1243 ABC transporter ATP-binding protein

Query= SwissProt::P23924
         (506 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1243 ABC transporter
           ATP-binding protein
          Length = 521

 Score =  256 bits (654), Expect = 1e-72
 Identities = 161/507 (31%), Positives = 268/507 (52%), Gaps = 14/507 (2%)

Query: 1   MGSTISPPSGEYLLEMRGINKSFPGVKALDNVNLNVRPHSIHALMGENGAGKSTLLKCLF 60
           M + +  P     L++R I+K +PG  A D ++L++ P  IHAL+GENGAGKSTL+K ++
Sbjct: 1   MSNPVPIPDQIPRLQLRRISKRYPGCLANDAIDLSIAPGEIHALLGENGAGKSTLMKIIY 60

Query: 61  GIYQKDSGSIVFQGKEVDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKGMF 120
           G+   DSG +++QG+ V   +  +A   GI MV Q  +L    SV  N+ L      G  
Sbjct: 61  GVTHADSGEMIWQGQRVTMRNPAQARGLGIGMVFQHFSLFETLSVAQNIALAMGAAAGT- 119

Query: 121 VDQDKMYQDTKAIFDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSL 180
               ++    + +     + ++P   V +LS+ + Q +EI +    + +++I+DEPTS L
Sbjct: 120 --PKQLEPKIREVSQRYGMALEPERLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVL 177

Query: 181 TEKEVNHLFTIIRKLKERGCGIVYISHKMEEIFQLCDEITILRDGQWIATQPLEGLDMDK 240
           T +E + LF  +R+L   GC I++ISHK+ E+  LC   T+LR G+ +A   +     D+
Sbjct: 178 TPQEADELFVTLRRLAAEGCSILFISHKLGEVRALCHSATVLRGGR-VAGHCVPAQCSDR 236

Query: 241 IIA-MMVGRSLNQRFPDKENKPGDVILEVRHLTSLRQP-----SIRDVSFDLHKGEILGI 294
            +A +MVG +        +    D  L V  L S   P     S++++ FD+  GEI+G+
Sbjct: 237 QLAQLMVGEAAELITDYPKVMGADAFLSVTGL-SWHNPDPFGCSLKNIDFDVRSGEIVGV 295

Query: 295 AGLVGAKRTDIVETLFG---IREKSSGTITLHGKKINNHTANEAINHGFALVTEERRSTG 351
           AG+ G  + +++  L G   +    S TI+  G+ + +   +     G A V  ER   G
Sbjct: 296 AGVAGNGQDELLALLSGEERLPRDDSATISFGGQPVAHLRPDARRKLGLAFVPAERLGHG 355

Query: 352 IYAYLDIGFNSLISNIRNYKNKVGLLDNSRMKSDTQWVIDSMRVKTPGHRTQIGSLSGGN 411
               L +  N+L++  +      GL+   ++++  + +I    VKTP       SLSGGN
Sbjct: 356 AVPELSLADNALLTAFQQGLVSHGLVQRGKVQALAEDIIRRFGVKTPDSLAPARSLSGGN 415

Query: 412 QQKVIIGRWLLTQPEILMLDEPTRGIDVGAKFEIYQLIAELAKKGKGIIIISSEMPELLG 471
            QK I+GR +L QP++L+   PT G+DVGA   I++ +  L   G  I++IS ++ EL  
Sbjct: 416 LQKFILGREILQQPKLLVAAHPTWGVDVGAAATIHRALIALRDAGAAILVISEDLDELFQ 475

Query: 472 ITDRILVMSNGLVSGIVDTKTTTQNEI 498
           I DR+  +  G +S +  T  T  +++
Sbjct: 476 ICDRLGALCGGQLSPLQATVDTHLSDV 502



 Score = 53.5 bits (127), Expect = 2e-11
 Identities = 54/232 (23%), Positives = 97/232 (41%), Gaps = 12/232 (5%)

Query: 28  ALDNVNLNVRPHSIHALMGENGAGKSTLLKCLFG---IYQKDSGSIVFQGKEVDFHSAKE 84
           +L N++ +VR   I  + G  G G+  LL  L G   + + DS +I F G+ V       
Sbjct: 279 SLKNIDFDVRSGEIVGVAGVAGNGQDELLALLSGEERLPRDDSATISFGGQPVAHLRPDA 338

Query: 85  ALENGISMVHQEL---NLVLQRSVMDNMWLGRYPTKGM----FVDQDKMYQDTKAIFDEL 137
             + G++ V  E      V + S+ DN  L  +  +G+     V + K+    + I    
Sbjct: 339 RRKLGLAFVPAERLGHGAVPELSLADNALLTAFQ-QGLVSHGLVQRGKVQALAEDIIRRF 397

Query: 138 DIDI-DPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFTIIRKLK 196
            +   D  A   +LS   +Q   + +      K+++   PT  +       +   +  L+
Sbjct: 398 GVKTPDSLAPARSLSGGNLQKFILGREILQQPKLLVAAHPTWGVDVGAAATIHRALIALR 457

Query: 197 ERGCGIVYISHKMEEIFQLCDEITILRDGQWIATQPLEGLDMDKIIAMMVGR 248
           + G  I+ IS  ++E+FQ+CD +  L  GQ    Q      +  +   M G+
Sbjct: 458 DAGAAILVISEDLDELFQICDRLGALCGGQLSPLQATVDTHLSDVGGWMAGQ 509


Lambda     K      H
   0.319    0.137    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 552
Number of extensions: 29
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 506
Length of database: 521
Length adjustment: 35
Effective length of query: 471
Effective length of database: 486
Effective search space:   228906
Effective search space used:   228906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory