Align ABC transporter for D-glucosamine, permease component 2 (characterized)
to candidate Pf1N1B4_5644 amino acid ABC transporter, permease protein
Query= reanno::pseudo3_N2E3:AO353_21720 (220 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5644 Length = 220 Score = 123 bits (308), Expect = 3e-33 Identities = 64/209 (30%), Positives = 120/209 (57%) Query: 11 LWVARDTLWSGFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRFYVDLIRGTPV 70 +W DTL +G ++ ++++I +G +IG++ L +R YV +IR TP+ Sbjct: 10 VWRDFDTLLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRPLRVLASVYVTVIRNTPI 69 Query: 71 FVLVLACFYMAPALGWQIDAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASKAIGL 130 VL+L ++ P+LG ++D + ++ L+L+ G+++ E+ RG L ++P+G EA AIGL Sbjct: 70 LVLILLIYFALPSLGVRLDKIPSFIITLSLYAGAYLTEVFRGGLLSIPKGLREAGLAIGL 129 Query: 131 TFYQALAYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTLE 190 +Q AY+ +P LR +LP N+ + K ++L + I V EL ++I ++ +E Sbjct: 130 GEWQVKAYITVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVIE 189 Query: 191 FYLFAGFLFFIINYAIELLGRHIEKRVAL 219 +L L+ Y I ++ R++E+R+A+ Sbjct: 190 TWLVTTALYVAACYLIAMMLRYLEQRLAI 218 Lambda K H 0.330 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 220 Length adjustment: 22 Effective length of query: 198 Effective length of database: 198 Effective search space: 39204 Effective search space used: 39204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory