Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate Pf1N1B4_5114 Maltose/maltodextrin ABC transporter, permease protein MalG
Query= reanno::Smeli:SM_b21219 (281 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5114 Length = 280 Score = 142 bits (359), Expect = 6e-39 Identities = 88/268 (32%), Positives = 147/268 (54%), Gaps = 12/268 (4%) Query: 18 LLAVVILAPVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLSAVENSAGAAFIASL 77 +L + + P + ++ S+ P++ L +++W + D S Y +L+ A+F+ ++ Sbjct: 21 VLLLYAVFPFYYAIVTSLKPSSALFE--VSYWIENPDFSNYAAVLNQ------ASFLRAI 72 Query: 78 LNSIKVAGMATLAAVVVAVPAAWAVSRTP--AVAWSLYAVIATYMLPPVALAVPLYMGLA 135 NS+ VA A+ +++ AA+A+ R L V+ M P VA+ L+ + Sbjct: 73 GNSLVVALCVVTLALFLSLTAAYALGRVKFRGRGTVLMMVLGVSMFPQVAVLSGLFEVIR 132 Query: 136 YFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDGARLDQILRILTLPL 195 GL N+ + L L Y PFT W+L + +P E+E AA++DGA L + LPL Sbjct: 133 ALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTRVLLPL 192 Query: 196 AAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVSD--YGLIATAGV 253 P + T+ L AF+ AW+EF +AL FT +T+ VAIA ++GG + +GL+ A V Sbjct: 193 LWPALVTTGLLAFIAAWNEFLFALTFTLTDTQRTVPVAIALISGGSPHELPWGLLMAASV 252 Query: 254 LAALPPVLIGLIMQRALISGLTSGGVKG 281 + +P V++ LI QR ++SGLT+G +KG Sbjct: 253 VVTVPLVILVLIFQRRIVSGLTAGALKG 280 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 280 Length adjustment: 26 Effective length of query: 255 Effective length of database: 254 Effective search space: 64770 Effective search space used: 64770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory