GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glucosaminate-lyase in Pseudomonas fluorescens FW300-N1B4

Align D-glucosaminate dehydratase (EC 4.3.1.9) (characterized)
to candidate Pf1N1B4_5639 D-serine deaminase (EC 4.3.1.18)

Query= reanno::pseudo13_GW456_L13:PfGW456L13_2867
         (405 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5639 D-serine deaminase
           (EC 4.3.1.18)
          Length = 405

 Score =  761 bits (1966), Expect = 0.0
 Identities = 380/405 (93%), Positives = 389/405 (96%)

Query: 1   MSSAPNTAAVEKGTAPKGASLVRDVSLPALVLHREALEHNIRWMQAFVSDSGAELAPHGK 60
           M SA NTAAVEKG A  GA+LVRDVSLPALVLHR+ALEHNIRWMQ FVS+SGAELAPHGK
Sbjct: 1   MYSAKNTAAVEKGFAHTGANLVRDVSLPALVLHRDALEHNIRWMQDFVSNSGAELAPHGK 60

Query: 61  TSMTPALFRRQLDAGAWGITLASATQTRAAYAHGVRRVLMANQLVGTPNMALIADLLADP 120
           TSMTPALFRRQLDAGAWGITLASATQTRAAYAHGV RVLMANQLVGTPNMALIADLLADP
Sbjct: 61  TSMTPALFRRQLDAGAWGITLASATQTRAAYAHGVHRVLMANQLVGTPNMALIADLLADP 120

Query: 121 TFDFYCMVDHPDNVADLGAYFASRGVRLNVMIEYGVVGGRCGCRSEQQVLDLAKAIAAQP 180
           TFDFYCMVDHPDNVADLGAYFASRGVRLNVMIEYGVVGGRCGCR+E +VL LAKAIAAQP
Sbjct: 121 TFDFYCMVDHPDNVADLGAYFASRGVRLNVMIEYGVVGGRCGCRTETEVLALAKAIAAQP 180

Query: 181 ALALTGIEGYEGVIHGDHAVTGIRDFAASLVRLAVQLQDSGAFAIPKPIITASGSAWYDL 240
           ALALTGIEGYEGVIHGDHAV+GIR FA SLVRLAVQLQDSGAFAI KPIITASGSAWYDL
Sbjct: 181 ALALTGIEGYEGVIHGDHAVSGIRAFADSLVRLAVQLQDSGAFAIAKPIITASGSAWYDL 240

Query: 241 IAESFEAQNAAGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLHEGLRPALEVWAHVQ 300
           IAESFEAQNA GRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLHEGLRPALEVWAHVQ
Sbjct: 241 IAESFEAQNACGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLHEGLRPALEVWAHVQ 300

Query: 301 SLPEPGFAVIALGKRDVAYDAGLPVPLLRYKAGVVPAEGDDVSVCKVTAVMDQHAFMTVA 360
           SLPEPGFAVIALGKRDVAYDAGLPVPLLRYKAGVVPA G+DV  CKVTAVMDQHAFMTVA
Sbjct: 301 SLPEPGFAVIALGKRDVAYDAGLPVPLLRYKAGVVPAIGEDVGACKVTAVMDQHAFMTVA 360

Query: 361 PGVDLRVGDIISFGTSHPCLTFDKWRVGCLVDEQLNVIETMETCF 405
           PGV+LRVGDIISFGTSHPCLTFDKWR+GCLVDEQLNVIETMETCF
Sbjct: 361 PGVELRVGDIISFGTSHPCLTFDKWRIGCLVDEQLNVIETMETCF 405


Lambda     K      H
   0.322    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 726
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 405
Length of database: 405
Length adjustment: 31
Effective length of query: 374
Effective length of database: 374
Effective search space:   139876
Effective search space used:   139876
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory