GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glk in Pseudomonas fluorescens FW300-N1B4

Align Glucokinase (EC 2.7.1.2) (characterized)
to candidate Pf1N1B4_600 Glucokinase (EC 2.7.1.2)

Query= reanno::WCS417:GFF4431
         (318 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600 Glucokinase (EC
           2.7.1.2)
          Length = 319

 Score =  563 bits (1450), Expect = e-165
 Identities = 272/316 (86%), Positives = 293/316 (92%)

Query: 1   MKLALVGDIGGTNARFALWRDQELHSIRVHATADHSSPEDAIKVYLKEEGLEIGDIGAVC 60
           +KLALVGDIGGTNARFALW++Q+L S++V ATADH+SPE+AI +YL   GL  G IG+VC
Sbjct: 1   LKLALVGDIGGTNARFALWKNQQLESVQVLATADHASPEEAIALYLSGLGLAPGSIGSVC 60

Query: 61  LSVAGPVSGDEFKFTNNHWRLSKTAFCKTLQVDELLLVNDFSAMALGMTRLKPDEFRVVC 120
           LSVAGPVSGDEFKFTNNHWRLS+  FCKTLQVD+LLLVNDFSAMALGMTRL+P EFRVVC
Sbjct: 61  LSVAGPVSGDEFKFTNNHWRLSRQGFCKTLQVDQLLLVNDFSAMALGMTRLQPGEFRVVC 120

Query: 121 EGTPEPLRPAVVIGPGTGLGVGTLLDLGAGRFAALPGEGGHVDLPLSSPRETQLWQHIYT 180
           EGTPEPLRPAVVIGPGTGLGVGTLLDLG GRFA LPGEGGHVDLPLSSPRETQLWQHI+ 
Sbjct: 121 EGTPEPLRPAVVIGPGTGLGVGTLLDLGEGRFAPLPGEGGHVDLPLSSPRETQLWQHIFN 180

Query: 181 EIGHVSAETALSGGGLPRLYRAICAVDGHTPVLETPEAITAAGLAGDPVAMEVLDQFSIW 240
           EIGHVSAETALSG GLPR+YRAICAVDGHTPVL+TPEAIT AGLAGDP+A+EVL+QF  W
Sbjct: 181 EIGHVSAETALSGSGLPRVYRAICAVDGHTPVLDTPEAITKAGLAGDPIALEVLEQFCCW 240

Query: 241 LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFINSGFAKSFADKGCMSDYFKGIPVWLVT 300
           LGRVAGNNVLTTG RGGVYIVGGVIPRFADFFI SGFA+ FADKGCMSDYFKGIPVWLVT
Sbjct: 241 LGRVAGNNVLTTGARGGVYIVGGVIPRFADFFIESGFARCFADKGCMSDYFKGIPVWLVT 300

Query: 301 APYSGLTGAGVALEQA 316
           APYSGL GAGVALEQ+
Sbjct: 301 APYSGLVGAGVALEQS 316


Lambda     K      H
   0.320    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 452
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 318
Length of database: 319
Length adjustment: 27
Effective length of query: 291
Effective length of database: 292
Effective search space:    84972
Effective search space used:    84972
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate Pf1N1B4_600 (Glucokinase (EC 2.7.1.2))
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00749.hmm
# target sequence database:        /tmp/gapView.22517.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00749  [M=315]
Accession:   TIGR00749
Description: glk: glucokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
      1e-80  257.3   0.0    1.2e-80  257.1   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600  Glucokinase (EC 2.7.1.2)


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600  Glucokinase (EC 2.7.1.2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  257.1   0.0   1.2e-80   1.2e-80       1     315 []       5     310 ..       5     310 .. 0.97

  Alignments for each domain:
  == domain 1  score: 257.1 bits;  conditional E-value: 1.2e-80
                                     TIGR00749   1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpi.kgcfaiatP 64 
                                                   lvgdiGGtnar+al     +++e+v+++ + d+ s e+++ +yl+      +  i   c+++a+P
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600   5 LVGDIGGTNARFAL--WKNQQLESVQVLATADHASPEEAIALYLSGLGLAPGS-IgSVCLSVAGP 66 
                                                   89************..8899**************************9999998.5499******* PP

                                     TIGR00749  65 iigdfvrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaia 129
                                                   + gd  ++tn++W ls +   ++l + +l l+ndf+a+a++++ l+  ++ ++    +e+  +  
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600  67 VSGDEFKFTNNHWRLSRQGFCKTLQVDQLLLVNDFSAMALGMTRLQPGEFRVVCEGTPEPLRPAV 131
                                                   ***************************************************************** PP

                                     TIGR00749 130 ilGaGtGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGl 194
                                                   ++G+GtGlGv tl++ ++gr+  l+geGghvd+   s+ e++l++ + +++g+vsae  lsGsGl
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600 132 VIGPGTGLGVGTLLDLGEGRFAPLPGEGGHVDLPLSSPRETQLWQHIFNEIGHVSAETALSGSGL 196
                                                   ***************************************************************** PP

                                     TIGR00749 195 vliyealskrkgerevsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklga 259
                                                     +y+a+   +g+  v  l     +++ i++a l+g+ ++a + le f+  lG++agn  l+ ga
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600 197 PRVYRAICAVDGHTPV--L----DTPEAITKAGLAGD-PIALEVLEQFCCWLGRVAGNNVLTTGA 254
                                                   **********966544..3....5899********96.89999********************** PP

                                     TIGR00749 260 rGGvyvaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315
                                                   rGGvy++GG++Prf +++ +s+f   f dkG + ++++ iPv +v     Gl+Gag
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_600 255 RGGVYIVGGVIPRFADFFIESGFARCFADKGCMSDYFKGIPVWLVTAPYSGLVGAG 310
                                                   ******************************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (315 nodes)
Target sequences:                          1  (319 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 11.91
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory