Align 2-hydroxy-3-oxopropionate reductase; EC 1.1.1.60; Tartronate semialdehyde reductase; TSAR (uncharacterized)
to candidate Pf1N1B4_1220 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)
Query= curated2:P77161 (292 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1220 Length = 291 Score = 118 bits (295), Expect = 2e-31 Identities = 85/282 (30%), Positives = 139/282 (49%), Gaps = 5/282 (1%) Query: 1 MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVA-DELLSLGAVSVETARQVTEASDII 59 M+LGFIGLG MG PM +NL +AGH++ V DEL GA V++ +A +++ Sbjct: 1 MELGFIGLGTMGVPMVLNLLKAGHRVKVWNRSSAPLDELARAGAQPVDSPALAAQA-EVL 59 Query: 60 FIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPV 119 M+ D + V G + G V+MS++S K FA E Y+ APV Sbjct: 60 ISMLGDDVAIRSVFIDGKGLDGLAA-GSVHVNMSTVSVALAKEFAALHTERDVAYVSAPV 118 Query: 120 SGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGD-GQTCKVANQIIVAL 178 G A G L+I+ G RV+PLF++LG+ G + K++ +++A Sbjct: 119 LGRVDVAAAGNLNILASGPAQALARVQPLFDVLGRKTWPFGECAELACVAKLSANLMIAS 178 Query: 179 NIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNP-GFKIALHQK 237 IE++++A AS G + + + + +G+ MI + F P GFK++L K Sbjct: 179 AIESMAQASTLASSYGISRATFIEMITSTLFPVPVYQGYGQLMIDKHFEPAGFKLSLGLK 238 Query: 238 DLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAL 279 D+ LAL++ +A + LP + ++ A+G D ++L Sbjct: 239 DIRLALEAGEAAQVPLPFASVLKDNLLDGMAHGQGDQDWASL 280 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 291 Length adjustment: 26 Effective length of query: 266 Effective length of database: 265 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory