Align tartronate semialdehyde reductase 2 (characterized)
to candidate Pf1N1B4_3659 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 Length = 256 Score = 338 bits (868), Expect = 6e-98 Identities = 167/253 (66%), Positives = 204/253 (80%) Query: 39 LSLGAVSVETARQVTEASDIIFIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPI 98 ++ GAV++ ++V + ++ I +MVPDTPQV++VLF +G KGK ++DMSSISP Sbjct: 1 VAAGAVALANPKEVAQEAEFIIVMVPDTPQVDDVLFRADGVAAGVSKGKVVIDMSSISPT 60 Query: 99 ETKRFARQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITL 158 TK FA ++NE G YLDAPVSGGE+GA+ TLSIMVGGD FER PLF+ +GKNITL Sbjct: 61 ATKAFAAKINEKGAQYLDAPVSGGEVGAKAATLSIMVGGDADAFERALPLFQAMGKNITL 120 Query: 159 VGGNGDGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHG 218 VGGNGDGQT KVANQIIVALNI+AV+EALLFASK GADP +VR+ALMGGFASS+ILEVHG Sbjct: 121 VGGNGDGQTAKVANQIIVALNIQAVAEALLFASKNGADPAKVREALMGGFASSKILEVHG 180 Query: 219 ERMIKRTFNPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSA 278 ERMIK TF+PGF+I+LHQKDLNLAL A+ L +NLPNTA Q++F+TCAA GGS DHSA Sbjct: 181 ERMIKGTFDPGFRISLHQKDLNLALAGARELGINLPNTANTQQVFSTCAAIGGSNWDHSA 240 Query: 279 LVQALELMANHKL 291 L++ LE MAN + Sbjct: 241 LIKGLEHMANFSI 253 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 256 Length adjustment: 25 Effective length of query: 267 Effective length of database: 231 Effective search space: 61677 Effective search space used: 61677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Pf1N1B4_3659 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.31315.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-109 351.0 8.1 2.8e-109 350.8 8.1 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 2-hydroxy-3-oxopropionate reduct Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 350.8 8.1 2.8e-109 2.8e-109 39 289 .. 1 251 [. 1 253 [. 0.99 Alignments for each domain: == domain 1 score: 350.8 bits; conditional E-value: 2.8e-109 TIGR01505 39 laaGaesaetakevvedadvivtmvPdsPqveevalGenGileaakkGkvlvdmssiaPleske 102 +aaGa++ kev+++a+ i++mvPd+Pqv++v++ +G+ + kGkv++dmssi+P ++k lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 1 VAAGAVALANPKEVAQEAEFIIVMVPDTPQVDDVLFRADGVAAGVSKGKVVIDMSSISPTATKA 64 699************************************************************* PP TIGR01505 103 lakavkekGidvldaPvsGGeagaiegtlsimvGGdkavfdkvkpllealgksivlvGenGaGq 166 +a +++ekG ++ldaPvsGGe+ga+ +tlsimvGGd f+++ pl++a+gk+i+lvG+nG+Gq lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 65 FAAKINEKGAQYLDAPVSGGEVGAKAATLSIMVGGDADAFERALPLFQAMGKNITLVGGNGDGQ 128 **************************************************************** PP TIGR01505 167 tvkvanqvivalnieavsealvlaekaGvdpkavlqalrGGlagstvleakkerlldrdfkPGf 230 t+kvanq+ivalni+av+eal++a+k G+dp +v++al+GG+a+s++le+++er+++ +f+PGf lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 129 TAKVANQIIVALNIQAVAEALLFASKNGADPAKVREALMGGFASSKILEVHGERMIKGTFDPGF 192 **************************************************************** PP TIGR01505 231 ridlhqkdlalaldaakavgaalPvtavvaellaalradGdgtldhsalvraleklakd 289 ri lhqkdl+lal a+++g++lP+ta ++++++++a G+++ dhsal++ le++a+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3659 193 RISLHQKDLNLALAGARELGINLPNTANTQQVFSTCAAIGGSNWDHSALIKGLEHMANF 251 *********************************************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (256 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.86 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory