Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate Pf1N1B4_5077 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)
Query= BRENDA::Q8ZLV8 (296 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5077 Length = 301 Score = 168 bits (426), Expect = 1e-46 Identities = 88/279 (31%), Positives = 153/279 (54%), Gaps = 1/279 (0%) Query: 5 VGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIIT 64 VG +GLG MG ++++LL++G+++ D G S+ +A +CDVIIT Sbjct: 6 VGVVGLGAMGLGIARSLLRSGFNVHACDVRAAVTEQFAGEGGVACSSPAHMAAECDVIIT 65 Query: 65 MLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPVSG 124 ++ N+ + V GE G + +PG+++I +++AP + ++ L A+G+ LDAP+SG Sbjct: 66 VVVNAEQTETVLFGEGGAVAALRPGSLVIGCATVAPTYAVDLGQRLTAQGLLYLDAPISG 125 Query: 125 GEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDI-GAGNVTKLANQVIVALNI 183 G KA G +++M G + K ++ MAG V GD G G+ K+ NQ++ ++I Sbjct: 126 GAAKAAAGEMTMMTSGPADAYAKAEAVLAGMAGKVYRLGDTHGLGSKVKIINQLLAGVHI 185 Query: 184 AAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLA 243 AA +EA+ L + GV+ D +Y+ I S + + + P ++ ++ P +D+ +KDL Sbjct: 186 AASAEAMALGLREGVDADALYEVITHSAGNSWMFENRVPHILKADYTPLSAVDIFVKDLG 245 Query: 244 NALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSAL 282 LDT+ LPL+A +M + G G +D SA+ Sbjct: 246 LVLDTARASKFPLPLSATAHQMFMQASSAGFGREDDSAV 284 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 301 Length adjustment: 27 Effective length of query: 269 Effective length of database: 274 Effective search space: 73706 Effective search space used: 73706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory