GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dhaM in Pseudomonas fluorescens FW300-N1B4

Align PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 (characterized)
to candidate Pf1N1B4_833 PTS system, glucose-specific IIA component / Phosphotransferase system, phosphocarrier protein HPr / Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)

Query= SwissProt::A0A0H3H456
         (472 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_833 PTS system,
           glucose-specific IIA component / Phosphotransferase
           system, phosphocarrier protein HPr /
           Phosphoenolpyruvate-protein phosphotransferase of PTS
           system (EC 2.7.3.9)
          Length = 844

 Score =  115 bits (287), Expect = 8e-30
 Identities = 96/322 (29%), Positives = 140/322 (43%), Gaps = 21/322 (6%)

Query: 158 SVSVVIQNHNGLHVRPASKLVAALAGFNADLVLEKGGKCVTPDSLNQIALLQVRRNDTLR 217
           S  V + N NGLH RPA+    A  GF A + L K        SL  I  LQ    D L+
Sbjct: 172 SKPVTLPNTNGLHARPAAVFAQAAKGFAASICLHKQQDSANAKSLVAIMALQTAHGDVLQ 231

Query: 218 LLARGPDADAALAAFQALAAENFGEPT------EAAPARRP---------ASADRVEGKV 262
           + A G DA+ A+     L A   GE        E   A+           AS     G+V
Sbjct: 232 VSAAGADAEVAIKTLAELLAAGCGEAVTLMAEVETVAAQVSSLTVLRGVCASPGAAFGQV 291

Query: 263 VLYPQPQDRISRETSAAIGQQQLRLKRAIDRTLEDLSALTTLAEATFSADIAAIFSGHHT 322
           V   +    +S E+  +   ++  L RA+ + +  L  L   A     ADI   F  H  
Sbjct: 292 VQIAEQTLEVS-ESGVSPQVEREHLSRALAKAVLALQQLRDKATGDAQADI---FKAHQE 347

Query: 323 LLDDPDLYAAACDIIRDEQCSAAWAWQQVLSDLSQQYRHLDDAYLQARYIDIEDILHRTL 382
           LL+DP L   A  +I D   SA +AW+      +  ++ L +A L  R  D+ D+  R L
Sbjct: 348 LLEDPGLLDQALALI-DAGKSAGFAWRAATESTATLFKKLGNALLAERAADLADVGQRVL 406

Query: 383 RHLNERNEALPQFSAPSILVADDIFPSTVLQLNAEQVKGICLQAGSELSHGAIIARQAGI 442
           + +    +   +    +IL+A+ + PS    L+  +V G     G   SH AI+AR +G+
Sbjct: 407 KLILGVEDRAMELPDGAILIAEQLTPSQTAGLDTRKVLGFATVGGGATSHVAILARASGL 466

Query: 443 AMLC-QQSDALTLQDGENVILD 463
             +C      LTL +G  V+LD
Sbjct: 467 PAICGLPVQVLTLINGTRVLLD 488


Lambda     K      H
   0.318    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 697
Number of extensions: 24
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 472
Length of database: 844
Length adjustment: 38
Effective length of query: 434
Effective length of database: 806
Effective search space:   349804
Effective search space used:   349804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory