Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate Pf1N1B4_2251 Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2251 Length = 268 Score = 165 bits (417), Expect = 1e-45 Identities = 92/223 (41%), Positives = 129/223 (57%), Gaps = 9/223 (4%) Query: 6 IQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRV 65 I V R + G R Q L+ +D + FV ++G SGCGKSTLLR++AGLD T G + Sbjct: 13 IPLVVRKLQKTFGSR-QVLREIDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLDKPTGGEL 71 Query: 66 LLDGAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGL 125 L AP+ + ++FQ L PW I N+ GL+ P+A + A VGL Sbjct: 72 LAGAAPLSEAREDTRLMFQEARLLPWKKIIDNVGLGLKGNWRPQALEALEA------VGL 125 Query: 126 RGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAE 185 +P LSGG +QR A+ARAL + P++LL+DEP GALD TR+ MQ+L+ +W+ Sbjct: 126 ADRANEWPAALSGGQKQRVALARALIHQPRLLLLDEPLGALDALTRIEMQQLIERLWQQH 185 Query: 186 RKTVLFVTHDIDEAIFMANRVAVFSARPGRIKTELAVDLPHPR 228 TVL VTHD+ EA+ +A+RV + G + +L V+LP PR Sbjct: 186 GFTVLLVTHDVSEAVAIADRVILI--EEGEVGLDLPVELPRPR 226 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 268 Length adjustment: 25 Effective length of query: 234 Effective length of database: 243 Effective search space: 56862 Effective search space used: 56862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory