Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate Pf1N1B4_1643 Amino acid ABC transporter, permease protein
Query= TCDB::Q9HU29 (230 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1643 Length = 229 Score = 340 bits (873), Expect = 1e-98 Identities = 166/227 (73%), Positives = 194/227 (85%) Query: 4 WELILKWMPKMLQGAALTLELLAIAVVAGLALALPLGIARASRHWYVRAVPYAYIFFFRG 63 WE+I+KW+PK+ QGA LTLEL+AIAV+AGL LA+PLGIAR+SR WYVRA PY YIFFFRG Sbjct: 3 WEVIIKWLPKLAQGATLTLELVAIAVIAGLLLAIPLGIARSSRLWYVRAFPYGYIFFFRG 62 Query: 64 TPLLLQLFIVYYGLAQFEEVRKSAFWPYLRDPYWCALLTMTLHTAAYIAEILRGAIHSVP 123 TPLL+QLF+VYYGLAQF+ VR S+ WPYLR P+WCA TMTLHTAAYIAEILRGAI ++P Sbjct: 63 TPLLVQLFLVYYGLAQFDAVRNSSMWPYLRSPFWCATATMTLHTAAYIAEILRGAIQAIP 122 Query: 124 VGEVEAARALGMSRRQALWHIILPRAVRIGLPAYSNEVILMLKASAVVYTVTLFDIMGMA 183 GE+EAARALGMSR +AL++I+LPRA RIGLPAYSNEVILMLKASA+ TVTL ++ GMA Sbjct: 123 PGEIEAARALGMSRTKALFYIMLPRAARIGLPAYSNEVILMLKASALASTVTLLELTGMA 182 Query: 184 RTIIARTYESMLFFCLAGALYLVITIVLTRIFRLIERWLRVDATQGR 230 RTIIARTY + F AG YL++ VL R F+L+ERWLRVDA QGR Sbjct: 183 RTIIARTYLPVEIFFAAGMFYLLMAYVLVRGFKLLERWLRVDACQGR 229 Lambda K H 0.332 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 230 Length of database: 229 Length adjustment: 23 Effective length of query: 207 Effective length of database: 206 Effective search space: 42642 Effective search space used: 42642 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory