Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate Pf1N1B4_1787 Enoyl-CoA hydratase (EC 4.2.1.17) / Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase (EC 5.3.3.8) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)
Query= BRENDA::P07896 (722 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1787 Length = 408 Score = 303 bits (775), Expect = 1e-86 Identities = 167/416 (40%), Positives = 245/416 (58%), Gaps = 28/416 (6%) Query: 296 VSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQ 355 + V+G GTMGRGI + A G+ V V+++P+ L+ A +T E A Q Sbjct: 8 IQRAAVIGAGTMGRGIVMCLANAGVPVQWVDNNPQMLEQA---LTSVAETYAHNVRQGRI 64 Query: 356 ASAKPKLRFSSSTKE-----LSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTS 410 A+ R + T + VDLV+EAV+E++ LK+K+F EL L KP A L +NTS Sbjct: 65 VQAEADARIARVTAAADYAAIRDVDLVIEAVYENLELKQKIFRELDGLLKPEAILASNTS 124 Query: 411 ALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGV 470 AL++D IA++T RPQ V+G HFFSPAH+M+LLE++ + P + + L K++GK+ V Sbjct: 125 ALDIDAIAAATRRPQQVLGLHFFSPAHIMKLLEIVRGAQTEPAVLDAALELGKRMGKVSV 184 Query: 471 VVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGW 530 V GNC+GF+GNRML PY + +L EG+ P VD L+ FGF MGPFR+ D+ G+D+ W Sbjct: 185 VSGNCHGFIGNRMLHPYVLEARKMLLEGALPYQVDAALQGFGFAMGPFRMYDVVGIDLEW 244 Query: 531 KIRK--GQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRI 588 + R+ G+G P + + + LCE GRFGQK+G G+Y Y+ P R Sbjct: 245 RARELAGKGQDAPEV---------------QVDNRLCELGRFGQKSGDGYYHYE-PGSRQ 288 Query: 589 HKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVI 648 + D + + + E ++R I EE+LERCL +L+NE +IL+EG+AA ID++ Sbjct: 289 AEHDLEVDALVLEVSEGLGFQRREIGPEEVLERCLLALVNEGAKILQEGIAASAHDIDLV 348 Query: 649 YLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQG 704 YL+GYG+P KGGPM +A GL + +L + + D P+ + LVA+G Sbjct: 349 YLNGYGFPADKGGPMAWADQQGLEDIHLRLLQLETKQGD--HWAPARLIGELVAEG 402 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 676 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 722 Length of database: 408 Length adjustment: 35 Effective length of query: 687 Effective length of database: 373 Effective search space: 256251 Effective search space used: 256251 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory