GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ivdG in Pseudomonas fluorescens FW300-N1B4

Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate Pf1N1B4_4785 Probable acyl-CoA dehydrogenase (EC 1.3.99.3)

Query= metacyc::MONOMER-11802
         (255 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4785 Probable acyl-CoA
           dehydrogenase (EC 1.3.99.3)
          Length = 253

 Score =  381 bits (979), Expect = e-111
 Identities = 203/255 (79%), Positives = 222/255 (87%), Gaps = 2/255 (0%)

Query: 1   MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADI 60
           M I NK F+V+G ASGLGAATA+MLV AGAKVMLVD+NA+AV A+A  LG  A+  VADI
Sbjct: 1   MQIENKVFLVTGGASGLGAATAEMLVAAGAKVMLVDMNAEAVAAQAARLG--AQSVVADI 58

Query: 61  SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFN 120
           S+E AAQ+AV A V AFG L+GLVNCAGIV  EK+LGK GPH L SF++VINVNLIGSFN
Sbjct: 59  SNEAAAQAAVQATVKAFGGLNGLVNCAGIVRGEKILGKNGPHALDSFSQVINVNLIGSFN 118

Query: 121 LLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELA 180
           +LRLAA A+AE  ADE GERGVIINTAS AA+DGQIGQAAY+ASKGAI SLTLPAARELA
Sbjct: 119 MLRLAATAIAETEADEDGERGVIINTASAAAFDGQIGQAAYSASKGAIVSLTLPAARELA 178

Query: 181 RFGIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIENSMLN 240
           RFGIRVMTIAPGIFETPMMAGM+ EVR SLAAGVPFPPRLG+  EYAAL RHIIENSMLN
Sbjct: 179 RFGIRVMTIAPGIFETPMMAGMTPEVRESLAAGVPFPPRLGKASEYAALVRHIIENSMLN 238

Query: 241 GEVIRLDGALRMAAK 255
           GEVIRLDGALRMAAK
Sbjct: 239 GEVIRLDGALRMAAK 253


Lambda     K      H
   0.318    0.131    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 235
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 255
Length of database: 253
Length adjustment: 24
Effective length of query: 231
Effective length of database: 229
Effective search space:    52899
Effective search space used:    52899
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory