GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdC in Pseudomonas fluorescens FW300-N1B4

Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate Pf1N1B4_4478 Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)

Query= reanno::pseudo13_GW456_L13:PfGW456L13_3542
         (425 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4478 Dihydrolipoamide
           acyltransferase component of branched-chain alpha-keto
           acid dehydrogenase complex (EC 2.3.1.168)
          Length = 423

 Score =  762 bits (1967), Expect = 0.0
 Identities = 399/425 (93%), Positives = 407/425 (95%), Gaps = 2/425 (0%)

Query: 1   MGTHVIKMPDIGEGIAEVELSVWHVKVGDMVVEDQVLADVMTDKAMVDIPSPVHGKVIAL 60
           MGTHVIKMPDIGEGIAEVELS WHVKVGDMVVEDQVLADVMTDKAMVDIPSPVHGKVIAL
Sbjct: 1   MGTHVIKMPDIGEGIAEVELSQWHVKVGDMVVEDQVLADVMTDKAMVDIPSPVHGKVIAL 60

Query: 61  GGQPGEVMAVGSVLISIEVEGAGNVKESAQPAPVVKEAPVAATKVETVVESKPVAAPAPK 120
           GGQPGEVMAVGS+LISIEVEGAGNVKESAQP   VKEAP AA KVE V+ESKPVAA AP+
Sbjct: 61  GGQPGEVMAVGSILISIEVEGAGNVKESAQPV-AVKEAPAAAPKVEAVLESKPVAAAAPR 119

Query: 121 AAVCQGPMVAREADERPLASPAVRKHALDLGIQLRLVRGTGPAGRVLHEDLDAYLAQGQS 180
            AVCQGPMVAREADERPLASPAVRKHALDLGIQLRLVRG+GPAGRVLHEDL+AYLAQGQS
Sbjct: 120 PAVCQGPMVAREADERPLASPAVRKHALDLGIQLRLVRGSGPAGRVLHEDLEAYLAQGQS 179

Query: 181 NASAPVAAAYAQRTDEQQIPVIGMRRKIAQRMQDATQRAAHFSYVEEIDVTAVEELRAHL 240
           NAS    AAYAQR DEQQIPVIGMRRKIAQRMQDATQRAAHFSYVEEIDVTAVEELRAHL
Sbjct: 180 NAST-ATAAYAQRNDEQQIPVIGMRRKIAQRMQDATQRAAHFSYVEEIDVTAVEELRAHL 238

Query: 241 NEKHGATRGKLTLLPFLVRALVVALRDFPQINARYDDEAQVITRLGAVHVGIATQADIGL 300
           NEKHGATRGKLTLLPFLVRALVVALRDFPQINARYDDEAQVITRLGAVHVG+ATQADIGL
Sbjct: 239 NEKHGATRGKLTLLPFLVRALVVALRDFPQINARYDDEAQVITRLGAVHVGVATQADIGL 298

Query: 301 MVPVVRHAEARSLWDSAAEISRLATAARNGKASRDELSGSTITLTSLGALGGIVSTPVLN 360
           MVPVVRHAE RSLWDSA EISRLATAAR GKASRDELSGSTITLTSLGALGGIVSTPVLN
Sbjct: 299 MVPVVRHAETRSLWDSATEISRLATAARTGKASRDELSGSTITLTSLGALGGIVSTPVLN 358

Query: 361 LPEVAIVGVNKIVERPMVIKGQIVIRKMMNLSSSFDHRVVDGMDAALFIQAIRGLLEQPA 420
           LPEVAIVGVNKIVERPMV+KGQ+VIRKMMNLSSSFDHRVVDGMDAA FIQAIRGLLEQPA
Sbjct: 359 LPEVAIVGVNKIVERPMVVKGQVVIRKMMNLSSSFDHRVVDGMDAAQFIQAIRGLLEQPA 418

Query: 421 TLFVE 425
           TLFVE
Sbjct: 419 TLFVE 423


Lambda     K      H
   0.318    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 660
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 425
Length of database: 423
Length adjustment: 32
Effective length of query: 393
Effective length of database: 391
Effective search space:   153663
Effective search space used:   153663
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory