Align Broad specificity amino-acid racemase; Broad spectrum racemase; EC 5.1.1.10 (characterized)
to candidate Pf1N1B4_2146 Alanine racemase (EC 5.1.1.1)
Query= SwissProt::Q88GJ9 (409 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2146 Length = 357 Score = 108 bits (269), Expect = 3e-28 Identities = 102/333 (30%), Positives = 155/333 (46%), Gaps = 22/333 (6%) Query: 48 VSASALQHNIRTLQAELAGKSKLCAVLKADAYGHGIGLVMPSIIAQGVPCVAVASNEEAR 107 + AL+HN + L E+ G +K AV+KADAYGHG ++ A+ AVA EEA Sbjct: 8 IDLQALRHNYQ-LAREVTG-AKALAVIKADAYGHGAVRCAQALEAEA-DGFAVACIEEAL 64 Query: 108 VVRASGFTGQLVRVR-LASLSELEDGLQYDMEELVGSAEFARQADAIA-ARHGKTLRIHM 165 +RA+G ++ + EL +++D +V S Q +AI A K + + + Sbjct: 65 ELRAAGIRAPVLLLEGFFEADELSLIVEHDFWCVVHSLW---QLEAIEKAALSKPITVWL 121 Query: 166 ALNSSGMSRNGVEMATWSGRGEALQITDQKHLKLVALMTHFAVEDKDDVRKGLAAFNEQT 225 L+S GM R G+ A + + L + K K+V LM+HFA D+ L Sbjct: 122 KLDS-GMHRVGLHPADYQAAYQRL-LASGKVAKIV-LMSHFARADE------LHCQTSAE 172 Query: 226 DWLIKHARLDRSKLTLHAANSFATLEVPEARLDMVRTGGALFGDTV-----PARTEYKRA 280 + A + NS A L P+ D VR G L+G T + + Sbjct: 173 QVAVFEAARQGLSAEISLRNSPAVLGWPQIPSDWVRPGIMLYGATPFEEANAVASRLQPV 232 Query: 281 MQFKSHVAAVHSYPAGNTVGYDRTFTLARDSRLANITVGYSDGYRRVFTNKGHVLINGHR 340 M +S V V P G +GY F + R+ + +GY+DGY R V++ G R Sbjct: 233 MTLESKVICVRELPTGEPIGYGAKFITPKPMRVGVVAMGYADGYPRQAPTGTPVMVAGQR 292 Query: 341 VPVVGKVSMNTLMVDVTDFPDVKGGNEVVLFGK 373 ++G+VSM+ L +D+TD P G+ V L+GK Sbjct: 293 SQLIGRVSMDMLCIDLTDVPQAGLGSPVELWGK 325 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 357 Length adjustment: 30 Effective length of query: 379 Effective length of database: 327 Effective search space: 123933 Effective search space used: 123933 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory