Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate Pf1N1B4_1093 FIG003879: Predicted amidohydrolase / Omega amidase (Nit2 homolog)
Query= reanno::pseudo5_N2C3_1:AO356_14225 (264 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1093 Length = 284 Score = 73.9 bits (180), Expect = 3e-18 Identities = 70/227 (30%), Positives = 101/227 (44%), Gaps = 28/227 (12%) Query: 31 GADVLVLPEMFMTGYNIGVDAVNVLAEVYNGEWAQQIGRIAKAANLAIVYGY----PERG 86 GA + VLPE F + + + G + + A+ L IV G P Sbjct: 32 GARLAVLPENFAAMGRRDIADIGRAEALGEGPILPWLKQTARDLKLWIVAGTLPLPPVDQ 91 Query: 87 EDGQIYNAVQLIDAQGERLANYRKSHLFGDLDHA----MFSAGD-----SALPIVELNGW 137 +++ L+D GE +A Y K HLF D+D A + D S + + + Sbjct: 92 PTAKVHACSLLVDDCGETVARYDKLHLF-DVDVADNRGRYRESDDYAYGSGVVVADTPVG 150 Query: 138 KLGLLICYDLEFPENARRLALAGAELILVPTANMQPYEFIA-------DVTVRARAIENQ 190 ++GL +CYDL FPE L AGAELI P+A F A DV +RARAIE Q Sbjct: 151 RVGLTVCYDLRFPELYSELRAAGAELITAPSA------FTAVTGAAHWDVLIRARAIETQ 204 Query: 191 CFVAYANYCG-HEAELQYCGQSSIAAPNGSRPALAGLDEALIVGELD 236 C++ A G H + G ++I P G A EA+++ + D Sbjct: 205 CYMLAAAQGGTHPGPRETFGHAAIVDPWGRVLAQQDQGEAVLLAQRD 251 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 284 Length adjustment: 25 Effective length of query: 239 Effective length of database: 259 Effective search space: 61901 Effective search space used: 61901 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory