Align ABC transporter for L-Lysine, permease component 2 (characterized)
to candidate Pf1N1B4_4793 Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)
Query= reanno::pseudo6_N2E2:Pf6N2E2_2960 (236 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4793 Length = 119 Score = 193 bits (490), Expect = 1e-54 Identities = 90/118 (76%), Positives = 109/118 (92%) Query: 119 EIFAGAIRSMNHGEVEAAKAYGLTGWRLYTYVIMPSALRRSLPYYSNEVILMLHSTTVAF 178 EIFAGAIRS+ +GE+EAA AYGL+GWRLY +I+PSALRR+LPYYSNEVILMLH+T+VAF Sbjct: 2 EIFAGAIRSIPYGEIEAAHAYGLSGWRLYLRLILPSALRRALPYYSNEVILMLHATSVAF 61 Query: 179 TATVPDVLKVARDANSATFLTFQSFGIAALIYLTVTFALVGLFRLAERRWLAFLGPTH 236 TAT+PD+LKVARDAN+ATF+TFQ+FGIA L+YL ++F LVG FRLAE+RWL+FLGP H Sbjct: 62 TATIPDILKVARDANAATFMTFQAFGIAGLLYLALSFGLVGAFRLAEKRWLSFLGPAH 119 Lambda K H 0.330 0.140 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 119 Length adjustment: 18 Effective length of query: 218 Effective length of database: 101 Effective search space: 22018 Effective search space used: 22018 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory