Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate Pf1N1B4_4792 Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)
Query= reanno::pseudo6_N2E2:Pf6N2E2_2959 (242 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4792 Length = 371 Score = 349 bits (896), Expect = e-101 Identities = 174/233 (74%), Positives = 203/233 (87%) Query: 6 LQNLGLSAFSLQGFGPLLMQGTWMTIKLSALSLLLSVLLGLLGASAKLSSVKLLRIPAQL 65 L +G+ SLQG+GPLL+ GTW+T+KLSALSLL+S+ LGLLGA+AKLS +KLL +PA Sbjct: 5 LNLIGVDLSSLQGYGPLLLHGTWVTLKLSALSLLVSMALGLLGAAAKLSPLKLLNLPATF 64 Query: 66 YTTLIRGVPDLVLMLLIFYSLQTWLTSLTDFMEWEYIEIDPFGAGVITLGFIYGAYFTET 125 YTTLIRGVPDLVLMLLIFYSLQ WL+SLT+ M+W Y+EIDPF AGV+TLGFIYGAYFTET Sbjct: 65 YTTLIRGVPDLVLMLLIFYSLQGWLSSLTEAMDWPYMEIDPFVAGVVTLGFIYGAYFTET 124 Query: 126 FRGAILSVPRGQVEAATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSII 185 FRGAILSVPRGQ EAA ++GL R QRFRFVVFPQMMRFALP +GNNW+V+LKATALVSII Sbjct: 125 FRGAILSVPRGQQEAAASFGLNRWQRFRFVVFPQMMRFALPSLGNNWLVLLKATALVSII 184 Query: 186 GLADLVKAAQDAGKSTYQLFYFLVLAALIYLLITSASNFILRWLERRYAAGAR 238 GL+DLVK AQ+AGKST+ + FL+LA +YLLITSASN++LR LERRY G R Sbjct: 185 GLSDLVKVAQEAGKSTFNMLDFLLLAGALYLLITSASNYVLRVLERRYNQGVR 237 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 371 Length adjustment: 27 Effective length of query: 215 Effective length of database: 344 Effective search space: 73960 Effective search space used: 73960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory