GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lysN in Pseudomonas fluorescens FW300-N1B4

Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate Pf1N1B4_4910 Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)

Query= reanno::Putida:PP_4108
         (416 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4910
           Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
           (EC 2.6.1.19)
          Length = 430

 Score =  353 bits (907), Expect = e-102
 Identities = 189/412 (45%), Positives = 255/412 (61%), Gaps = 4/412 (0%)

Query: 6   ISQSIAIVHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLT 65
           + + +   HP+ +   + +E+WD DGKRY+DFVGGIGVLN+GH +P VV A+QAQ  +++
Sbjct: 19  VPRGLVTAHPLVIDRAQGSELWDVDGKRYLDFVGGIGVLNIGHNHPKVVAAVQAQLQKVS 78

Query: 66  HYAFNAAPHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAIIAF 125
           H  F    + PYL L ++L + +            SGAEA ENA+K+AR  T + A+IAF
Sbjct: 79  HACFQVVAYKPYLDLAQRLCEMIGGQESYKAAFFTSGAEAVENAVKIARAHTNRSAVIAF 138

Query: 126 DGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVE 185
            GGFHGRTL    L G   PYKQ  G     V+H PYP+A  GVT + ALKA+D L + +
Sbjct: 139 RGGFHGRTLLGTTLTGMSQPYKQNFGPFAPEVFHTPYPNAYRGVTSDMALKALDELLATQ 198

Query: 186 LAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAF 245
           +A E VAA I EPVQG+GGFL+    F QALR    + GI++I+DEIQ+GFGRTG+ F F
Sbjct: 199 VAPERVAAIIIEPVQGDGGFLSAPTEFLQALRALTAKHGIVLILDEIQTGFGRTGKWFGF 258

Query: 246 PRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQ 305
              GI+PDL+ +AKS+AGG+PL  VVG+ E+M A   GGLGGTY GN +SCAAALA +  
Sbjct: 259 QHAGIQPDLVTVAKSLAGGLPLSGVVGKAEIMDAPLPGGLGGTYGGNALSCAAALAVIEA 318

Query: 306 MTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAP-AQL 364
              E L   GE   + +     R +A    P IG + G G M  IE    D +  P A L
Sbjct: 319 YEQEQLLARGEALGERLREGLLRLQAR--YPRIGDVRGSGFMLAIELIKDDDARTPDADL 376

Query: 365 -AKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415
             ++++ ARA GLL++  G  R+++R LAPL      ++E L IL+  LA +
Sbjct: 377 NQRLIDEARAGGLLVIKCGVYRNVLRFLAPLVTSEAQVDEALQILDAALARV 428


Lambda     K      H
   0.320    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 550
Number of extensions: 19
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 416
Length of database: 430
Length adjustment: 32
Effective length of query: 384
Effective length of database: 398
Effective search space:   152832
Effective search space used:   152832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory